BLASTX nr result
ID: Forsythia22_contig00050731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050731 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075244.1| PREDICTED: jmjC domain-containing protein 7 ... 57 4e-06 >ref|XP_011075244.1| PREDICTED: jmjC domain-containing protein 7 [Sesamum indicum] Length = 382 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -3 Query: 97 AMEVEEKIQNLWQEVRDLSLGTPPQVDHLPTP 2 A +E +QNLWQEVR+LSLGTPP +DHLPTP Sbjct: 2 AERIESSVQNLWQEVRELSLGTPPHIDHLPTP 33