BLASTX nr result
ID: Forsythia22_contig00050258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050258 (332 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099063.1| PREDICTED: alpha/beta hydrolase domain-conta... 59 2e-06 ref|XP_010663064.1| PREDICTED: alpha/beta hydrolase domain-conta... 59 2e-06 emb|CBI14904.3| unnamed protein product [Vitis vinifera] 59 2e-06 gb|KJB23557.1| hypothetical protein B456_004G1046002, partial [G... 58 3e-06 ref|XP_009775221.1| PREDICTED: alpha/beta hydrolase domain-conta... 58 3e-06 ref|XP_009619454.1| PREDICTED: alpha/beta hydrolase domain-conta... 58 3e-06 ref|XP_008362229.1| PREDICTED: alpha/beta hydrolase domain-conta... 58 3e-06 gb|KHN05806.1| Abhydrolase domain-containing protein FAM108C1-li... 57 4e-06 ref|XP_003523119.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 4e-06 ref|XP_010102924.1| hypothetical protein L484_018942 [Morus nota... 57 5e-06 ref|XP_012852018.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_012568828.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_011086992.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_011085578.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_011013691.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 gb|KHN07964.1| Abhydrolase domain-containing protein FAM108B1-li... 57 5e-06 ref|XP_010037484.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_009765518.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_009763101.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 ref|XP_009594597.1| PREDICTED: alpha/beta hydrolase domain-conta... 57 5e-06 >ref|XP_011099063.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Sesamum indicum] gi|747101841|ref|XP_011099064.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Sesamum indicum] Length = 378 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLVQCPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVQCPVLVIH 208 >ref|XP_010663064.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Vitis vinifera] Length = 387 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLVQCPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVQCPVLVIH 208 >emb|CBI14904.3| unnamed protein product [Vitis vinifera] Length = 359 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLVQCPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVQCPVLVIH 208 >gb|KJB23557.1| hypothetical protein B456_004G1046002, partial [Gossypium raimondii] Length = 139 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIHTLNRLS*KTC 105 RTYWFDIYKN+DKIPLV CPVL+IH L +C Sbjct: 45 RTYWFDIYKNIDKIPLVNCPVLIIHCLKYKQKDSC 79 >ref|XP_009775221.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana sylvestris] gi|698572732|ref|XP_009775222.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana sylvestris] Length = 377 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKNVDKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNVDKIPLVECPVLVIH 208 >ref|XP_009619454.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] gi|697130805|ref|XP_009619455.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] gi|697130807|ref|XP_009619456.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] gi|697130809|ref|XP_009619457.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Nicotiana tomentosiformis] Length = 377 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKNVDKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNVDKIPLVECPVLVIH 208 >ref|XP_008362229.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like isoform X2 [Malus domestica] Length = 231 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIHTL 81 RTYWFDIYKN+DKIPLV CPVLVIH L Sbjct: 184 RTYWFDIYKNIDKIPLVSCPVLVIHML 210 >gb|KHN05806.1| Abhydrolase domain-containing protein FAM108C1-like protein [Glycine soja] Length = 380 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKNVDKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNVDKIPLVKCPVLVIH 208 >ref|XP_003523119.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Glycine max] Length = 380 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKNVDKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNVDKIPLVKCPVLVIH 208 >ref|XP_010102924.1| hypothetical protein L484_018942 [Morus notabilis] gi|587906370|gb|EXB94442.1| hypothetical protein L484_018942 [Morus notabilis] Length = 372 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVKCPVLVIH 208 >ref|XP_012852018.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C [Erythranthe guttatus] Length = 372 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVKCPVLVIH 208 >ref|XP_012568828.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C isoform X1 [Cicer arietinum] Length = 211 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIHTL 81 RTYWFDIYKN+DKIPLV CPVLVIH + Sbjct: 184 RTYWFDIYKNIDKIPLVNCPVLVIHLM 210 >ref|XP_011086992.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like [Sesamum indicum] Length = 371 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVKCPVLVIH 208 >ref|XP_011085578.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Sesamum indicum] Length = 319 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 186 RTYWFDIYKNIDKIPLVRCPVLVIH 210 >ref|XP_011013691.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Populus euphratica] Length = 369 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVKCPVLVIH 208 >gb|KHN07964.1| Abhydrolase domain-containing protein FAM108B1-like protein [Glycine soja] Length = 368 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 171 RTYWFDIYKNIDKIPLVKCPVLVIH 195 >ref|XP_010037484.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like isoform X1 [Eucalyptus grandis] Length = 388 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 201 RTYWFDIYKNIDKIPLVKCPVLVIH 225 >ref|XP_009765518.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Nicotiana sylvestris] Length = 285 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/25 (88%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVL+IH Sbjct: 184 RTYWFDIYKNIDKIPLVECPVLIIH 208 >ref|XP_009763101.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17C-like [Nicotiana sylvestris] Length = 370 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 184 RTYWFDIYKNIDKIPLVKCPVLVIH 208 >ref|XP_009594597.1| PREDICTED: alpha/beta hydrolase domain-containing protein 17B-like, partial [Nicotiana tomentosiformis] Length = 269 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 RTYWFDIYKNVDKIPLVQCPVLVIH 75 RTYWFDIYKN+DKIPLV+CPVLVIH Sbjct: 83 RTYWFDIYKNIDKIPLVKCPVLVIH 107