BLASTX nr result
ID: Forsythia22_contig00050217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050217 (417 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] 89 1e-15 emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] 89 1e-15 ref|WP_048460945.1| hypothetical protein, partial [Streptomyces ... 87 3e-15 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 86 1e-14 gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 86 1e-14 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 85 2e-14 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 84 3e-14 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 81 3e-13 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 80 4e-13 emb|CAB85630.1| putative metallothionein-like protein [Vitis vin... 77 3e-12 ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas p... 77 4e-12 ref|XP_012084959.1| PREDICTED: metallothionein-like protein type... 77 6e-12 gb|AAX39389.1| metallothionein-like protein [Oryza officinalis] 77 6e-12 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 77 6e-12 ref|NP_001042319.1| Os01g0200700 [Oryza sativa Japonica Group] g... 75 1e-11 sp|A3B0Y1.1|MT3B_ORYSJ RecName: Full=Metallothionein-like protei... 75 2e-11 gb|EMT20371.1| hypothetical protein F775_43862 [Aegilops tauschii] 74 4e-11 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 74 5e-11 gb|AAB95220.1| metallothionein type I [Fritillaria agrestis] gi|... 74 5e-11 gb|AAB95219.1| metallothionein type I [Fritillaria agrestis] 74 5e-11 >gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] Length = 63 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKC 217 MSTCG+CDCADKSQCVKKGN YG+VI+ETEKS FEEVVEV A+ E D KC Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAEPDCKC 50 >emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] Length = 63 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKC 217 MSTCG+CDCADKSQCVKKGN YG+VI+ETEKS FEEVVEV A+ E D KC Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAEPDCKC 50 >ref|WP_048460945.1| hypothetical protein, partial [Streptomyces sp. HNS054] Length = 88 Score = 87.4 bits (215), Expect = 3e-15 Identities = 41/63 (65%), Positives = 45/63 (71%) Frame = -1 Query: 402 FSFSIQVTQSLNMSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDG 223 FS + S MSTCGNCDCADKSQCVKKGN YGV IVETEKS + + EV + END Sbjct: 12 FSLAFATFPSTAMSTCGNCDCADKSQCVKKGNGYGVDIVETEKSYYGDAGEVVTAAENDP 71 Query: 222 KCK 214 KCK Sbjct: 72 KCK 74 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 85.9 bits (211), Expect = 1e-14 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDCADKSQCVKKGN+YG+ I+ETEKS + VVE A+ +N+G+CK Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVVEAPAAAKNEGECK 51 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 85.5 bits (210), Expect = 1e-14 Identities = 35/51 (68%), Positives = 44/51 (86%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDCADKSQCVKKGN+YG+ I+ETEKS F V++ +A+ E++G CK Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDASAAAEHEGNCK 51 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDCADKSQCVKKGN+YG+ I+ETEKS F V++ A+ E++G CK Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDAPAAAEHEGNCK 51 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 84.3 bits (207), Expect = 3e-14 Identities = 36/51 (70%), Positives = 42/51 (82%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDC DKSQCVKKGN+YG+ IVETEKS +EV+ + E+DGKCK Sbjct: 1 MSTCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAEHDGKCK 51 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 80.9 bits (198), Expect = 3e-13 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDCADKSQCVKKGN Y + I+ETEKS ++ V + E+DGKCK Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAEHDGKCK 51 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDCADKSQCVKKGN+YGV I+ETEKS + V EV A+ +N+G CK Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEV-AAAKNEGNCK 50 >emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 77.4 bits (189), Expect = 3e-12 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 366 MSTCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 MSTCGNCDCADKSQCVKKGN+YG+ IVETEKS VV + +++G CK Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHEGSCK 51 >ref|WP_045734788.1| hypothetical protein, partial [Pseudomonas pseudoalcaligenes] gi|782990300|gb|KJU81265.1| hypothetical protein N619_00020, partial [Pseudomonas pseudoalcaligenes] Length = 87 Score = 77.0 bits (188), Expect = 4e-12 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -1 Query: 363 STCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 STCGNCDCADKSQCVKKG++YG+ IVET KS E +V + E+DGKCK Sbjct: 24 STCGNCDCADKSQCVKKGSSYGIDIVETGKSYVETIVMDAPAAEHDGKCK 73 >ref|XP_012084959.1| PREDICTED: metallothionein-like protein type 3 [Jatropha curcas] gi|282848222|gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] gi|643714554|gb|KDP27057.1| hypothetical protein JCGZ_20992 [Jatropha curcas] Length = 67 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/51 (70%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -1 Query: 363 STCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVV-EVTASGENDGKCK 214 STCGNCDCADKSQCVKKG++Y IVETEKS +V +V A ENDGKCK Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAENDGKCK 53 >gb|AAX39389.1| metallothionein-like protein [Oryza officinalis] Length = 64 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/48 (77%), Positives = 39/48 (81%) Frame = -1 Query: 357 CGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 CGNCDCADKSQCVKKG +YGVVIV+ EKS FE EV S ENDGKCK Sbjct: 5 CGNCDCADKSQCVKKGTSYGVVIVDAEKSHFEMAEEV--SYENDGKCK 50 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/50 (72%), Positives = 40/50 (80%) Frame = -1 Query: 363 STCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 +TCGNCDCADK+QCVK GN YGV IVETEK + E VV +GENDGKCK Sbjct: 3 NTCGNCDCADKTQCVK-GNKYGVDIVETEKRMVETVVMEVPAGENDGKCK 51 >ref|NP_001042319.1| Os01g0200700 [Oryza sativa Japonica Group] gi|158512839|sp|A2WLS0.1|MT3A_ORYSI RecName: Full=Metallothionein-like protein 3A; AltName: Full=Class I metallothionein-like protein 3A; AltName: Full=OsMT-I-3a; Short=OsMT3; Short=OsMT3a gi|158514033|sp|A1YTM8.1|MT3A_ORYSJ RecName: Full=Metallothionein-like protein 3A; AltName: Full=Class I metallothionein-like protein 3A; AltName: Full=OsMT-I-3a; Short=OsMT3; Short=OsMT3a gi|2072555|gb|AAB53811.1| metallothionein-like protein [Oryza sativa Japonica Group] gi|6103441|gb|AAF03603.1| metallothionein-like protein [Oryza sativa] gi|20804518|dbj|BAB92212.1| putative metallothionein-like protein [Oryza sativa Japonica Group] gi|53148415|dbj|BAD52235.1| metallothionein [Oryza rufipogon] gi|53148419|dbj|BAD52237.1| metallothionein [Oryza rufipogon] gi|53148421|dbj|BAD52238.1| metallothionein [Oryza rufipogon] gi|53148435|dbj|BAD52245.1| metallothionein [Oryza barthii] gi|113531850|dbj|BAF04233.1| Os01g0200700 [Oryza sativa Japonica Group] gi|119393775|gb|ABL74404.1| type 3 metallothionein [Oryza sativa Japonica Group] gi|125524802|gb|EAY72916.1| hypothetical protein OsI_00789 [Oryza sativa Indica Group] gi|125569407|gb|EAZ10922.1| hypothetical protein OsJ_00763 [Oryza sativa Japonica Group] gi|149392305|gb|ABR25984.1| metallothionein-like protein [Oryza sativa Indica Group] gi|164375529|gb|ABY52932.1| metallothionein-like protein [Oryza sativa Japonica Group] gi|169244503|gb|ACA50525.1| metallothionein-like protein [Oryza sativa Japonica Group] Length = 62 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = -1 Query: 357 CGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 CGNCDCADKSQCVKKG +YGVVIVE EKS FEEV A+GE +G CK Sbjct: 5 CGNCDCADKSQCVKKGTSYGVVIVEAEKSHFEEV----AAGEENGGCK 48 >sp|A3B0Y1.1|MT3B_ORYSJ RecName: Full=Metallothionein-like protein 3B; AltName: Full=Class I metallothionein-like protein 3B; AltName: Full=OsMT-I-3b gi|50878333|gb|AAT85108.1| putative metallothionein [Oryza sativa Japonica Group] gi|222630544|gb|EEE62676.1| hypothetical protein OsJ_17479 [Oryza sativa Japonica Group] Length = 65 Score = 75.1 bits (183), Expect = 2e-11 Identities = 36/48 (75%), Positives = 38/48 (79%) Frame = -1 Query: 357 CGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 CGNCDCADKSQCVKKG +YGVVIV+ EKS FE EV ENDGKCK Sbjct: 5 CGNCDCADKSQCVKKGTSYGVVIVDAEKSHFEMAEEV-GYEENDGKCK 51 >gb|EMT20371.1| hypothetical protein F775_43862 [Aegilops tauschii] Length = 62 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -1 Query: 357 CGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKC 217 CGNCDCADK+QCVKKGN YG+V+V+TEKS F EV + ENDGKC Sbjct: 5 CGNCDCADKTQCVKKGNTYGIVMVDTEKSHF----EVQETAENDGKC 47 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -1 Query: 363 STCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 STCGNCDCADKSQCVKKG++Y IVETEKS ++ + E+DGKCK Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHDGKCK 52 >gb|AAB95220.1| metallothionein type I [Fritillaria agrestis] gi|183013702|gb|ACC38380.1| metallothionein-like protein [Lilium formosanum] Length = 63 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -1 Query: 363 STCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 STCGNCDCADK+QCVKK N++GVVI+ETEKS F+ +++V E+D KCK Sbjct: 3 STCGNCDCADKNQCVKKSNSFGVVIMETEKSYFDGMMDV---AEHDPKCK 49 >gb|AAB95219.1| metallothionein type I [Fritillaria agrestis] Length = 63 Score = 73.6 bits (179), Expect = 5e-11 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = -1 Query: 363 STCGNCDCADKSQCVKKGNNYGVVIVETEKSIFEEVVEVTASGENDGKCK 214 STCGNCDCADK+QCVKK N++GVVI+ETEKS F+ +++V E+D KCK Sbjct: 3 STCGNCDCADKNQCVKKSNSFGVVIMETEKSYFDGMMDV---AEHDPKCK 49