BLASTX nr result
ID: Forsythia22_contig00050121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050121 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002488994.1| hypothetical protein SORBIDRAFT_0610s002010 ... 64 5e-08 gb|KHG21056.1| Lysine histidine transporter 1 -like protein [Gos... 59 1e-06 ref|XP_009601963.1| PREDICTED: lysine histidine transporter 1-li... 59 1e-06 ref|XP_009381698.1| PREDICTED: lysine histidine transporter 1 [M... 59 1e-06 ref|XP_009359311.1| PREDICTED: lysine histidine transporter 2 is... 59 1e-06 ref|XP_008340170.1| PREDICTED: lysine histidine transporter 2-li... 59 1e-06 emb|CBI27555.3| unnamed protein product [Vitis vinifera] 59 1e-06 gb|EPS70921.1| hypothetical protein M569_03830, partial [Genlise... 59 1e-06 ref|XP_002270050.1| PREDICTED: lysine histidine transporter 1 [V... 59 1e-06 emb|CAN75546.1| hypothetical protein VITISV_035992 [Vitis vinifera] 59 1e-06 ref|XP_004236736.1| PREDICTED: lysine histidine transporter 2-li... 59 1e-06 ref|XP_010111627.1| hypothetical protein L484_017653 [Morus nota... 58 2e-06 ref|XP_010111626.1| hypothetical protein L484_017652 [Morus nota... 58 2e-06 gb|KJB33934.1| hypothetical protein B456_006G039200 [Gossypium r... 58 2e-06 gb|KJB33933.1| hypothetical protein B456_006G039200 [Gossypium r... 58 2e-06 ref|XP_012483927.1| PREDICTED: lysine histidine transporter 1 [G... 58 2e-06 ref|XP_011098833.1| PREDICTED: lysine histidine transporter 1-li... 58 2e-06 ref|XP_011045191.1| PREDICTED: lysine histidine transporter 1 [P... 58 2e-06 ref|XP_010932713.1| PREDICTED: lysine histidine transporter 1-li... 58 2e-06 ref|XP_010550273.1| PREDICTED: lysine histidine transporter 1-li... 58 2e-06 >ref|XP_002488994.1| hypothetical protein SORBIDRAFT_0610s002010 [Sorghum bicolor] gi|241947373|gb|EES20518.1| hypothetical protein SORBIDRAFT_0610s002010 [Sorghum bicolor] Length = 437 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGWYVHWGQ 179 YSAFHNVTAMVGAGVL LP+AM++LGWYVH G+ Sbjct: 39 YSAFHNVTAMVGAGVLGLPFAMSQLGWYVHGGE 71 >gb|KHG21056.1| Lysine histidine transporter 1 -like protein [Gossypium arboreum] Length = 433 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 27 YSAFHNVTAMVGAGVLSLPYAMAELGW 53 >ref|XP_009601963.1| PREDICTED: lysine histidine transporter 1-like [Nicotiana tomentosiformis] Length = 455 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 42 YSAFHNVTAMVGAGVLSLPYAMAELGW 68 >ref|XP_009381698.1| PREDICTED: lysine histidine transporter 1 [Musa acuminata subsp. malaccensis] Length = 438 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 33 YSAFHNVTAMVGAGVLSLPYAMAELGW 59 >ref|XP_009359311.1| PREDICTED: lysine histidine transporter 2 isoform X1 [Pyrus x bretschneideri] Length = 440 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 34 YSAFHNVTAMVGAGVLSLPYAMAELGW 60 >ref|XP_008340170.1| PREDICTED: lysine histidine transporter 2-like [Malus domestica] Length = 438 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 32 YSAFHNVTAMVGAGVLSLPYAMAELGW 58 >emb|CBI27555.3| unnamed protein product [Vitis vinifera] Length = 471 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 65 YSAFHNVTAMVGAGVLSLPYAMAELGW 91 >gb|EPS70921.1| hypothetical protein M569_03830, partial [Genlisea aurea] Length = 439 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 34 YSAFHNVTAMVGAGVLSLPYAMAELGW 60 >ref|XP_002270050.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera] Length = 437 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 31 YSAFHNVTAMVGAGVLSLPYAMAELGW 57 >emb|CAN75546.1| hypothetical protein VITISV_035992 [Vitis vinifera] Length = 426 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMAELGW Sbjct: 31 YSAFHNVTAMVGAGVLSLPYAMAELGW 57 >ref|XP_004236736.1| PREDICTED: lysine histidine transporter 2-like [Solanum lycopersicum] Length = 439 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGWYVHWG 182 YS FHNVTAMVGAGVLSLPYAM+++GWY WG Sbjct: 33 YSTFHNVTAMVGAGVLSLPYAMSQMGWY--WG 62 >ref|XP_010111627.1| hypothetical protein L484_017653 [Morus notabilis] gi|587944935|gb|EXC31372.1| hypothetical protein L484_017653 [Morus notabilis] Length = 500 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 68 YSAFHNVTAMVGAGVLSLPYAMSELGW 94 >ref|XP_010111626.1| hypothetical protein L484_017652 [Morus notabilis] gi|587944934|gb|EXC31371.1| hypothetical protein L484_017652 [Morus notabilis] Length = 448 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 42 YSAFHNVTAMVGAGVLSLPYAMSELGW 68 >gb|KJB33934.1| hypothetical protein B456_006G039200 [Gossypium raimondii] Length = 426 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 43 YSAFHNVTAMVGAGVLSLPYAMSELGW 69 >gb|KJB33933.1| hypothetical protein B456_006G039200 [Gossypium raimondii] Length = 480 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 43 YSAFHNVTAMVGAGVLSLPYAMSELGW 69 >ref|XP_012483927.1| PREDICTED: lysine histidine transporter 1 [Gossypium raimondii] gi|763766717|gb|KJB33932.1| hypothetical protein B456_006G039200 [Gossypium raimondii] Length = 449 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 43 YSAFHNVTAMVGAGVLSLPYAMSELGW 69 >ref|XP_011098833.1| PREDICTED: lysine histidine transporter 1-like [Sesamum indicum] Length = 445 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 39 YSAFHNVTAMVGAGVLSLPYAMSELGW 65 >ref|XP_011045191.1| PREDICTED: lysine histidine transporter 1 [Populus euphratica] Length = 449 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 43 YSAFHNVTAMVGAGVLSLPYAMSELGW 69 >ref|XP_010932713.1| PREDICTED: lysine histidine transporter 1-like [Elaeis guineensis] Length = 439 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAM+ELGW Sbjct: 33 YSAFHNVTAMVGAGVLSLPYAMSELGW 59 >ref|XP_010550273.1| PREDICTED: lysine histidine transporter 1-like [Tarenaya hassleriana] Length = 448 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -1 Query: 277 YSAFHNVTAMVGAGVLSLPYAMAELGW 197 YSAFHNVTAMVGAGVLSLPYAMA+LGW Sbjct: 42 YSAFHNVTAMVGAGVLSLPYAMAQLGW 68