BLASTX nr result
ID: Forsythia22_contig00050017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00050017 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009762406.1| PREDICTED: double-stranded RNA-binding prote... 64 8e-12 ref|XP_009606187.1| PREDICTED: double-stranded RNA-binding prote... 64 1e-11 ref|XP_004239670.1| PREDICTED: double-stranded RNA-binding prote... 63 2e-11 ref|XP_006345796.1| PREDICTED: double-stranded RNA-binding prote... 63 2e-11 ref|XP_009598424.1| PREDICTED: double-stranded RNA-binding prote... 64 8e-11 ref|XP_009770304.1| PREDICTED: double-stranded RNA-binding prote... 64 8e-11 ref|XP_010253679.1| PREDICTED: double-stranded RNA-binding prote... 62 1e-10 ref|XP_002285171.1| PREDICTED: double-stranded RNA-binding prote... 62 1e-10 emb|CAN80689.1| hypothetical protein VITISV_005501 [Vitis vinifera] 62 1e-10 emb|CBI16317.3| unnamed protein product [Vitis vinifera] 62 1e-10 ref|XP_008785282.1| PREDICTED: double-stranded RNA-binding prote... 57 1e-10 ref|XP_002529947.1| double-stranded RNA binding protein, putativ... 62 2e-10 ref|XP_011084339.1| PREDICTED: double-stranded RNA-binding prote... 60 2e-10 gb|KDO73296.1| hypothetical protein CISIN_1g012154mg [Citrus sin... 62 3e-10 ref|XP_006424566.1| hypothetical protein CICLE_v10028358mg [Citr... 62 3e-10 ref|XP_010521763.1| PREDICTED: double-stranded RNA-binding prote... 62 3e-10 ref|XP_004487104.1| PREDICTED: double-stranded RNA-binding prote... 62 3e-10 ref|XP_007150197.1| hypothetical protein PHAVU_005G134700g [Phas... 62 3e-10 ref|XP_003597250.1| Ribonuclease [Medicago truncatula] gi|355486... 62 3e-10 ref|XP_010264682.1| PREDICTED: double-stranded RNA-binding prote... 60 3e-10 >ref|XP_009762406.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana sylvestris] Length = 481 Score = 63.5 bits (153), Expect(3) = 8e-12 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCSTLRQ 55 Score = 30.0 bits (66), Expect(3) = 8e-12 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ LA+ GP+NSLAA Sbjct: 60 AAEVALNALASRGPSNSLAA 79 Score = 22.3 bits (46), Expect(3) = 8e-12 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_009606187.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tomentosiformis] Length = 481 Score = 63.5 bits (153), Expect(3) = 1e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCSTLRQ 55 Score = 29.6 bits (65), Expect(3) = 1e-11 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ LA GP+NSLAA Sbjct: 60 AAEVALNALANRGPSNSLAA 79 Score = 22.3 bits (46), Expect(3) = 1e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_004239670.1| PREDICTED: double-stranded RNA-binding protein 2-like [Solanum lycopersicum] Length = 553 Score = 63.2 bits (152), Expect(3) = 2e-11 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGE+FE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEVFESPNYCSTLRQ 55 Score = 29.3 bits (64), Expect(3) = 2e-11 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP+NSLAA Sbjct: 60 AAEVALNSLSNRGPSNSLAA 79 Score = 22.3 bits (46), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_006345796.1| PREDICTED: double-stranded RNA-binding protein 2-like [Solanum tuberosum] Length = 506 Score = 63.2 bits (152), Expect(3) = 2e-11 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGE+FE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEVFESPNYCSTLRQ 55 Score = 29.3 bits (64), Expect(3) = 2e-11 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP+NSLAA Sbjct: 60 AAEVALNSLSNRGPSNSLAA 79 Score = 22.3 bits (46), Expect(3) = 2e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_009598424.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana tomentosiformis] Length = 472 Score = 63.5 bits (153), Expect(3) = 8e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 8e-11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ LA GP+ SLAA Sbjct: 60 AAEVALNALANRGPSYSLAA 79 Score = 22.3 bits (46), Expect(3) = 8e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_009770304.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nicotiana sylvestris] Length = 448 Score = 63.5 bits (153), Expect(3) = 8e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 8e-11 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ LA GP+ SLAA Sbjct: 60 AAEVALNALANRGPSYSLAA 79 Score = 22.3 bits (46), Expect(3) = 8e-11 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_010253679.1| PREDICTED: double-stranded RNA-binding protein 2 [Nelumbo nucifera] Length = 429 Score = 62.4 bits (150), Expect(3) = 1e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY +TLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCTTLRQ 55 Score = 27.3 bits (59), Expect(3) = 1e-10 Identities = 12/20 (60%), Positives = 18/20 (90%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAE+AL+ L++ GP++SLAA Sbjct: 60 AAEIALNSLSSRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 1e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_002285171.1| PREDICTED: double-stranded RNA-binding protein 2 [Vitis vinifera] Length = 413 Score = 62.4 bits (150), Expect(3) = 1e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY +TLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCTTLRQ 55 Score = 27.3 bits (59), Expect(3) = 1e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNSLSNRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 1e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >emb|CAN80689.1| hypothetical protein VITISV_005501 [Vitis vinifera] Length = 403 Score = 62.4 bits (150), Expect(3) = 1e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY +TLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCTTLRQ 55 Score = 27.3 bits (59), Expect(3) = 1e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNSLSNRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 1e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >emb|CBI16317.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 62.4 bits (150), Expect(3) = 1e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE PNY +TLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPNYCTTLRQ 55 Score = 27.3 bits (59), Expect(3) = 1e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNSLSNRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 1e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_008785282.1| PREDICTED: double-stranded RNA-binding protein 6 [Phoenix dactylifera] Length = 401 Score = 57.4 bits (137), Expect(3) = 1e-10 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNG++FE P++ +TLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGDVFESPSFCTTLRQ 55 Score = 32.0 bits (71), Expect(3) = 1e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL L+TCGP++SLAA Sbjct: 60 AAEVALIALSTCGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 1e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_002529947.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223530577|gb|EEF32455.1| double-stranded RNA binding protein, putative [Ricinus communis] Length = 464 Score = 61.6 bits (148), Expect(3) = 2e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFECPHYCSTLRQ 55 Score = 27.3 bits (59), Expect(3) = 2e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALTSLSNRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 2e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_011084339.1| PREDICTED: double-stranded RNA-binding protein 2-like [Sesamum indicum] Length = 479 Score = 60.5 bits (145), Expect(3) = 2e-10 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KA VNFNGE+FE PNY STLR+ Sbjct: 22 CIREGPDHAPRFKAAVNFNGEMFESPNYCSTLRQ 55 Score = 28.1 bits (61), Expect(3) = 2e-10 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAE AL LA+ GP+NSLAA Sbjct: 60 AAEAALDALASRGPSNSLAA 79 Score = 22.3 bits (46), Expect(3) = 2e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >gb|KDO73296.1| hypothetical protein CISIN_1g012154mg [Citrus sinensis] Length = 470 Score = 61.6 bits (148), Expect(3) = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPHYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 3e-10 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVALS L+ GP+ SLAA Sbjct: 60 AAEVALSSLSHRGPSPSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_006424566.1| hypothetical protein CICLE_v10028358mg [Citrus clementina] gi|568869760|ref|XP_006488085.1| PREDICTED: double-stranded RNA-binding protein 2-like isoform X1 [Citrus sinensis] gi|568869762|ref|XP_006488086.1| PREDICTED: double-stranded RNA-binding protein 2-like isoform X2 [Citrus sinensis] gi|557526500|gb|ESR37806.1| hypothetical protein CICLE_v10028358mg [Citrus clementina] Length = 470 Score = 61.6 bits (148), Expect(3) = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPHYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 3e-10 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVALS L+ GP+ SLAA Sbjct: 60 AAEVALSSLSHRGPSPSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_010521763.1| PREDICTED: double-stranded RNA-binding protein 2 [Tarenaya hassleriana] Length = 445 Score = 61.6 bits (148), Expect(3) = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPHYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 3e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNALSNRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_004487104.1| PREDICTED: double-stranded RNA-binding protein 2-like [Cicer arietinum] Length = 425 Score = 61.6 bits (148), Expect(3) = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPHYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 3e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNSLSHRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_007150197.1| hypothetical protein PHAVU_005G134700g [Phaseolus vulgaris] gi|561023461|gb|ESW22191.1| hypothetical protein PHAVU_005G134700g [Phaseolus vulgaris] Length = 410 Score = 61.6 bits (148), Expect(3) = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPHYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 3e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNSLSHRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_003597250.1| Ribonuclease [Medicago truncatula] gi|355486298|gb|AES67501.1| double-stranded RNA-binding motif protein [Medicago truncatula] Length = 408 Score = 61.6 bits (148), Expect(3) = 3e-10 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGEIFE P+Y STLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGEIFESPHYCSTLRQ 55 Score = 26.6 bits (57), Expect(3) = 3e-10 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L+ GP++SLAA Sbjct: 60 AAEVALNSLSHRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21 >ref|XP_010264682.1| PREDICTED: double-stranded RNA-binding protein 2-like [Nelumbo nucifera] Length = 388 Score = 60.5 bits (145), Expect(3) = 3e-10 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 158 CIREDPDYAPRYKATVNFNGEIFEFPNYYSTLRR 57 CIRE PD+APR+KATVNFNGE FE PNY +TLR+ Sbjct: 22 CIREGPDHAPRFKATVNFNGETFESPNYCTTLRQ 55 Score = 27.7 bits (60), Expect(3) = 3e-10 Identities = 13/20 (65%), Positives = 18/20 (90%) Frame = -1 Query: 61 AAEVALSDLATCGPTNSLAA 2 AAEVAL+ L++ GP++SLAA Sbjct: 60 AAEVALNSLSSRGPSHSLAA 79 Score = 22.3 bits (46), Expect(3) = 3e-10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 189 RSCFNTPLYT 160 RSCFN P YT Sbjct: 12 RSCFNLPSYT 21