BLASTX nr result
ID: Forsythia22_contig00049481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00049481 (337 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012478961.1| PREDICTED: uncharacterized protein LOC105794... 57 5e-06 >ref|XP_012478961.1| PREDICTED: uncharacterized protein LOC105794361 [Gossypium raimondii] gi|763763462|gb|KJB30716.1| hypothetical protein B456_005G156500 [Gossypium raimondii] Length = 105 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/53 (52%), Positives = 41/53 (77%), Gaps = 5/53 (9%) Frame = -1 Query: 145 KKRVSAATTNNNK-----EDGFMGSVPIHSQVRKIRQEMEKINHPALQQPEIR 2 +K++S+++++NN ED + G VPIHSQV KI+QE EKI HP+LQQP++R Sbjct: 27 QKKISSSSSSNNNAVIRDEDEYKG-VPIHSQVMKIKQEFEKIKHPSLQQPDMR 78