BLASTX nr result
ID: Forsythia22_contig00049433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00049433 (287 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831688.1| PREDICTED: uncharacterized protein LOC105952... 62 1e-07 >ref|XP_012831688.1| PREDICTED: uncharacterized protein LOC105952653 [Erythranthe guttatus] gi|604343126|gb|EYU42109.1| hypothetical protein MIMGU_mgv1a006212mg [Erythranthe guttata] Length = 452 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = +1 Query: 115 MAECHIQIQVEESRSPQDQSPLLENTGETQDSNHQENQENDNETRLDKTLLQLESVL 285 MAE IQI+ EES +P + +PLL+N ETQ N +++END ETRLDKTL +L+ L Sbjct: 1 MAEVQIQIEAEESITPHETTPLLKNPDETQVPNPPDDEENDKETRLDKTLQRLDFFL 57