BLASTX nr result
ID: Forsythia22_contig00049063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00049063 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076487.1| PREDICTED: pentatricopeptide repeat-containi... 70 7e-10 emb|CDP05212.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_010255448.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_011470378.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_012090268.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_008234467.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 ref|XP_007219543.1| hypothetical protein PRUPE_ppa022784mg [Prun... 63 9e-08 ref|XP_009340067.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_011030096.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_006377070.1| hypothetical protein POPTR_0012s13270g [Popu... 59 1e-06 ref|XP_010662774.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_002510801.1| pentatricopeptide repeat-containing protein,... 56 8e-06 >ref|XP_011076487.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Sesamum indicum] Length = 554 Score = 69.7 bits (169), Expect = 7e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -2 Query: 144 QVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 +V N L QCT+KQL+ +HA II TSL +IP+IRLKFLRRSTE+G MEY Sbjct: 8 KVFNSLQQCTYKQLKQIHAFIITTSLGQIPDIRLKFLRRSTEYGEMEY 55 >emb|CDP05212.1| unnamed protein product [Coffea canephora] Length = 562 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/55 (58%), Positives = 43/55 (78%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 MP L +V+N L CTF+QL+ +HA+I+ +SL + P+IRLKFLRRSTEFG M+Y Sbjct: 1 MPCPLQQKVANQLQVCTFRQLKQIHAIIVTSSLHQNPQIRLKFLRRSTEFGDMDY 55 >ref|XP_010255448.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nelumbo nucifera] Length = 564 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 M SSL ++SNLL +CTF QL+ +HALI TSL+R I K LRRSTEFGGM+Y Sbjct: 1 MHSSLEQRISNLLQKCTFTQLKQIHALITTTSLNRDIRISTKTLRRSTEFGGMDY 55 >ref|XP_011470378.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Fragaria vesca subsp. vesca] Length = 545 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/55 (61%), Positives = 41/55 (74%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 M SL L++S LL QCTFKQL+ +HALI+ TSL + + KFLRRSTEFG MEY Sbjct: 1 MAYSLELKLSKLLPQCTFKQLKQIHALIVTTSLHKDIQTFSKFLRRSTEFGAMEY 55 >ref|XP_012090268.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Jatropha curcas] Length = 554 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/55 (56%), Positives = 42/55 (76%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 MP +L L++SN+L +CTF+ L+ +HALII SL R +I +FLRRSTEFG M+Y Sbjct: 1 MPCTLRLKISNILPKCTFQHLKQIHALIIAASLARNIQIISRFLRRSTEFGSMDY 55 >ref|XP_008234467.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Prunus mume] Length = 579 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 M SL L +S +L QCTF+QL+ +HALI+ T L++ +I KFLRRSTEFG MEY Sbjct: 4 MACSLELNLSKVLPQCTFRQLKQIHALIVTTFLNQNIQIFSKFLRRSTEFGTMEY 58 >ref|XP_007219543.1| hypothetical protein PRUPE_ppa022784mg [Prunus persica] gi|462416005|gb|EMJ20742.1| hypothetical protein PRUPE_ppa022784mg [Prunus persica] Length = 498 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 M SL L +S +L QCTF+QL+ +HALI+ T L++ +I KFLRRSTEFG MEY Sbjct: 1 MACSLELNLSKVLPQCTFRQLKQIHALIVTTFLNQNIQIFSKFLRRSTEFGTMEY 55 >ref|XP_009340067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Pyrus x bretschneideri] Length = 590 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 M SL +S LL Q TFKQL+ +HALI+ TS+++ +I KFLRRSTEFG MEY Sbjct: 1 MRGSLEFTLSKLLPQSTFKQLKQIHALIVTTSINQNIQIFSKFLRRSTEFGSMEY 55 >ref|XP_011030096.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Populus euphratica] Length = 553 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 MP +L L++S L +CTF+ L+ +HALII SL + +I KFLRR+TEFG M+Y Sbjct: 1 MPCNLELKISKTLPKCTFQHLKQIHALIITCSLSKNIKIFSKFLRRTTEFGRMDY 55 >ref|XP_006377070.1| hypothetical protein POPTR_0012s13270g [Populus trichocarpa] gi|550327037|gb|ERP54867.1| hypothetical protein POPTR_0012s13270g [Populus trichocarpa] Length = 480 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 MP +L L++S L +CTF+ L+ +HALII SL + +I KFLRR+TEFG M+Y Sbjct: 1 MPCNLELKISKTLPKCTFQHLKQIHALIITCSLSKNIKIFSKFLRRTTEFGRMDY 55 >ref|XP_010662774.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vitis vinifera] Length = 561 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -2 Query: 153 LALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 L ++ LL QCTF QL+ +HA I+ TSL +I KFLRRSTEFG MEY Sbjct: 5 LEQRIPYLLQQCTFNQLKQIHAFILTTSLLHDIQISSKFLRRSTEFGAMEY 55 >ref|XP_002510801.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549916|gb|EEF51403.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 450 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/55 (49%), Positives = 38/55 (69%) Frame = -2 Query: 165 MPSSLALQVSNLLNQCTFKQLQLLHALIIKTSLDRIPEIRLKFLRRSTEFGGMEY 1 MP + ++S++L +CTF+ L+ +HA II SL +I KFLRRSTEFG M+Y Sbjct: 1 MPCNFQEKISHILPKCTFQHLKQIHAFIIAASLTHNIQIFSKFLRRSTEFGSMDY 55