BLASTX nr result
ID: Forsythia22_contig00048325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00048325 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009781122.1| PREDICTED: guanylate-binding protein 4-like,... 52 4e-07 >ref|XP_009781122.1| PREDICTED: guanylate-binding protein 4-like, partial [Nicotiana sylvestris] Length = 538 Score = 51.6 bits (122), Expect(2) = 4e-07 Identities = 25/58 (43%), Positives = 36/58 (62%) Frame = +1 Query: 19 IAQGVFHYLAQEKNALELWKNLEILYNGTTARHKVFLIKIIGNLKYKDDHNLLEHMNE 192 I VFH++AQE +A LW LE +Y TAR+K L++ + NLK K ++ EH +E Sbjct: 372 IDDSVFHHVAQETDAYALWVKLEGMYQAKTARNKALLMRRLVNLKLKHGTSVAEHTSE 429 Score = 28.9 bits (63), Expect(2) = 4e-07 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = +3 Query: 204 PMYDELQALLLLSLFPNTCETL 269 P+ DE++ALLLLS P++ ETL Sbjct: 443 PLGDEMKALLLLSSLPDSWETL 464