BLASTX nr result
ID: Forsythia22_contig00047149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00047149 (342 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835810.1| PREDICTED: mannan synthase 1-like [Erythrant... 71 2e-10 ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2... 71 2e-10 ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1... 71 2e-10 ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2... 71 2e-10 ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1... 71 2e-10 gb|EYU38560.1| hypothetical protein MIMGU_mgv1a017694mg [Erythra... 71 2e-10 ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum t... 71 3e-10 ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum l... 71 3e-10 emb|CDP06773.1| unnamed protein product [Coffea canephora] 70 7e-10 gb|KDO49989.1| hypothetical protein CISIN_1g044519mg [Citrus sin... 70 7e-10 gb|ACE60600.1| mannan synthase [Coffea canephora] 70 7e-10 gb|KEH24032.1| cellulose synthase-like protein A1 [Medicago trun... 69 2e-09 ref|XP_006428366.1| hypothetical protein CICLE_v10013685mg [Citr... 69 2e-09 gb|AFV79650.1| mannan synthase [Trigonella foenum-graecum] 68 2e-09 gb|EYU29872.1| hypothetical protein MIMGU_mgv1a023425mg [Erythra... 68 3e-09 ref|XP_004493996.1| PREDICTED: mannan synthase 1 [Cicer arietinum] 67 4e-09 gb|KHN09524.1| Mannan synthase 1 [Glycine soja] 67 6e-09 gb|KHN02317.1| Mannan synthase 1 [Glycine soja] 67 6e-09 gb|EPS59546.1| mannan synthase, partial [Genlisea aurea] 67 6e-09 ref|XP_003553558.1| PREDICTED: mannan synthase 1-like [Glycine max] 67 6e-09 >ref|XP_012835810.1| PREDICTED: mannan synthase 1-like [Erythranthe guttatus] Length = 216 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGA CGLSWPSDRLIVQVLDDSTNEALR Sbjct: 41 IPMFNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEALR 81 >ref|XP_009765562.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana sylvestris] Length = 527 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWPSDRLIVQVLDDSTNE LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEVLR 138 >ref|XP_009765561.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana sylvestris] Length = 556 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWPSDRLIVQVLDDSTNE LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEVLR 138 >ref|XP_009597672.1| PREDICTED: mannan synthase 1-like isoform X2 [Nicotiana tomentosiformis] Length = 527 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWPSDRLIVQVLDDSTNE LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEVLR 138 >ref|XP_009597671.1| PREDICTED: mannan synthase 1-like isoform X1 [Nicotiana tomentosiformis] Length = 556 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWPSDRLIVQVLDDSTNE LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEVLR 138 >gb|EYU38560.1| hypothetical protein MIMGU_mgv1a017694mg [Erythranthe guttata] Length = 527 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGA CGLSWPSDRLIVQVLDDSTNEALR Sbjct: 98 IPMFNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEALR 138 >ref|XP_006354365.1| PREDICTED: mannan synthase 1-like [Solanum tuberosum] Length = 527 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWPSDRL+VQVLDDSTNE LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPSDRLVVQVLDDSTNEVLR 138 >ref|XP_004246627.1| PREDICTED: mannan synthase 1-like [Solanum lycopersicum] Length = 527 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWPSDRL+VQVLDDSTNE LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPSDRLVVQVLDDSTNEVLR 138 >emb|CDP06773.1| unnamed protein product [Coffea canephora] Length = 530 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGA CGLSWPSDRLIVQVLDDSTNE LR Sbjct: 100 IPMFNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEVLR 140 >gb|KDO49989.1| hypothetical protein CISIN_1g044519mg [Citrus sinensis] Length = 534 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALRVFF 274 IP + +VYKLSIGA CGLSWPSDRLIVQVLDDSTNE LR F Sbjct: 97 IPMYNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEVLRTDF 140 >gb|ACE60600.1| mannan synthase [Coffea canephora] Length = 530 Score = 69.7 bits (169), Expect = 7e-10 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGA CGLSWPSDRLIVQVLDDSTNE LR Sbjct: 100 IPMFNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEVLR 140 >gb|KEH24032.1| cellulose synthase-like protein A1 [Medicago truncatula] Length = 529 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWP DRLIVQVLDDSTN+ LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPGDRLIVQVLDDSTNQVLR 138 >ref|XP_006428366.1| hypothetical protein CICLE_v10013685mg [Citrus clementina] gi|557530423|gb|ESR41606.1| hypothetical protein CICLE_v10013685mg [Citrus clementina] Length = 434 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP + +VYKLSIGA CGLSWPSDRLIVQVLDDSTNE LR Sbjct: 52 IPMYNEKEVYKLSIGAACGLSWPSDRLIVQVLDDSTNEVLR 92 >gb|AFV79650.1| mannan synthase [Trigonella foenum-graecum] Length = 534 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGAVCGLSWP DRLIVQVLDDSTN+ LR Sbjct: 98 IPMFNEKEVYKLSIGAVCGLSWPRDRLIVQVLDDSTNQVLR 138 >gb|EYU29872.1| hypothetical protein MIMGU_mgv1a023425mg [Erythranthe guttata] Length = 515 Score = 67.8 bits (164), Expect = 3e-09 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALRV 268 IP F +VYKLSIGAV GLSWPSD+LIVQVLDDSTNE LRV Sbjct: 98 IPMFNEKEVYKLSIGAVSGLSWPSDKLIVQVLDDSTNETLRV 139 >ref|XP_004493996.1| PREDICTED: mannan synthase 1 [Cicer arietinum] Length = 527 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP + +VYKLSIGAVCGLSWP+DRL+VQVLDDSTN+ LR Sbjct: 98 IPMYNEKEVYKLSIGAVCGLSWPADRLVVQVLDDSTNQVLR 138 >gb|KHN09524.1| Mannan synthase 1 [Glycine soja] Length = 481 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP + +VYKLSIGAVCGLSWP+DR IVQVLDDSTN++LR Sbjct: 52 IPMYNEKEVYKLSIGAVCGLSWPADRFIVQVLDDSTNQSLR 92 >gb|KHN02317.1| Mannan synthase 1 [Glycine soja] Length = 496 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP + +VYKLSIGAVCGLSWP+DR IVQVLDDSTN++LR Sbjct: 98 IPMYNEKEVYKLSIGAVCGLSWPADRFIVQVLDDSTNQSLR 138 >gb|EPS59546.1| mannan synthase, partial [Genlisea aurea] Length = 344 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP F +VYKLSIGA CGLSWPSD+L+VQVLDDSTNE L+ Sbjct: 85 IPMFNEKEVYKLSIGAACGLSWPSDKLVVQVLDDSTNELLK 125 >ref|XP_003553558.1| PREDICTED: mannan synthase 1-like [Glycine max] Length = 528 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = +2 Query: 143 IPNFLFAKVYKLSIGAVCGLSWPSDRLIVQVLDDSTNEALR 265 IP + +VYKLSIGAVCGLSWP+DR IVQVLDDSTN++LR Sbjct: 98 IPMYNEKEVYKLSIGAVCGLSWPADRFIVQVLDDSTNQSLR 138