BLASTX nr result
ID: Forsythia22_contig00046906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00046906 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086984.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_012829314.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 >ref|XP_011086984.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Sesamum indicum] Length = 710 Score = 62.4 bits (150), Expect = 1e-07 Identities = 35/88 (39%), Positives = 51/88 (57%), Gaps = 3/88 (3%) Frame = -3 Query: 256 LNQRYFISPSSLPSLYTHQFSTPLFFVITKTPQK--KPTVXXXXXXXXXXXSIFLPFLQN 83 L+ ++FIS SS SL + F TP +I K Q+ + IFLPFLQ Sbjct: 5 LHSQFFISFSSFSSLSSPNFQTPQLLIIPKRSQRNLREVFCIASASTPHSSPIFLPFLQT 64 Query: 82 PGKKETHKP-EFSKIEEINDPILKFFKT 2 P +K+T +P + ++++ I+DPILKFFKT Sbjct: 65 PARKQTQEPQQKNEVDNIDDPILKFFKT 92 >ref|XP_012829314.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Erythranthe guttatus] gi|604297562|gb|EYU17775.1| hypothetical protein MIMGU_mgv1a002101mg [Erythranthe guttata] Length = 714 Score = 59.7 bits (143), Expect = 8e-07 Identities = 37/89 (41%), Positives = 47/89 (52%), Gaps = 4/89 (4%) Frame = -3 Query: 256 LNQRYFISPSSLPSLYTHQFSTPLFFVITKTPQKKPTVXXXXXXXXXXXS----IFLPFL 89 L++R+ IS S SL++ F P F I K + + T IFLPFL Sbjct: 8 LHRRFSISSSPSYSLHSPHFPIPNLFKIPKLSKNQRTTFSVCCSSTSPPPPSSPIFLPFL 67 Query: 88 QNPGKKETHKPEFSKIEEINDPILKFFKT 2 Q P +K+T KPE EINDPI+KFFKT Sbjct: 68 QTPARKQTPKPEPEIETEINDPIVKFFKT 96