BLASTX nr result
ID: Forsythia22_contig00046198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00046198 (772 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009049761.1| hypothetical protein (mitochondrion) [Capsic... 80 1e-12 ref|YP_006291827.1| orf43 gene product (mitochondrion) [Daucus c... 68 7e-09 gb|AHJ81032.1| orf108a (mitochondrion) [Panax ginseng] 50 3e-06 >ref|YP_009049761.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667751874|gb|AIG89961.1| hypothetical protein (mitochondrion) [Capsicum annuum] gi|667752033|gb|AIG90119.1| hypothetical protein (mitochondrion) [Capsicum annuum] Length = 142 Score = 80.1 bits (196), Expect = 1e-12 Identities = 39/48 (81%), Positives = 40/48 (83%) Frame = +3 Query: 228 IRRKGFAFRLLFEAGLDERKQVRDSLSLSAWRGSPPCHLKGKQEEGLR 371 I RKGFAFR LFEAGLDER QVRDSLSLSAW GSPPCHLKG+ E R Sbjct: 80 IGRKGFAFRSLFEAGLDERGQVRDSLSLSAWSGSPPCHLKGEVAEASR 127 >ref|YP_006291827.1| orf43 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081989|gb|AEY81181.1| orf43 (mitochondrion) [Daucus carota subsp. sativus] Length = 171 Score = 67.8 bits (164), Expect = 7e-09 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = -1 Query: 364 PSSCFPFK*QGGEPRQAESDSESRTCLRSSKPASKSNRKAKPFLRI 227 PS FP +GG P QAESDSESRTC RSSKP SKS+RKAKPFL I Sbjct: 21 PSLAFPLSDKGGGPLQAESDSESRTCPRSSKPTSKSDRKAKPFLPI 66 >gb|AHJ81032.1| orf108a (mitochondrion) [Panax ginseng] Length = 97 Score = 49.7 bits (117), Expect(3) = 3e-06 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = -3 Query: 467 PLCWLGEEGISMAKDSIQPQVP 402 PLCWLGEEGIS+AKDSIQPQVP Sbjct: 25 PLCWLGEEGISIAKDSIQPQVP 46 Score = 28.1 bits (61), Expect(3) = 3e-06 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 402 LRLPCYSFTSVED 364 LRLPCY FT VED Sbjct: 47 LRLPCYDFTPVED 59 Score = 20.8 bits (42), Expect(3) = 3e-06 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -1 Query: 499 SPAPYQWEQAT 467 SPA +QW+QA+ Sbjct: 14 SPARHQWKQAS 24