BLASTX nr result
ID: Forsythia22_contig00045910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00045910 (534 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008664452.1| PREDICTED: uncharacterized protein LOC103643... 59 1e-06 tpg|DAA48328.1| TPA: hypothetical protein ZEAMMB73_262778, parti... 59 1e-06 ref|XP_012472494.1| PREDICTED: 60S ribosomal protein L38-like [G... 58 2e-06 ref|XP_002514807.1| 60S ribosomal protein L38, putative [Ricinus... 58 3e-06 ref|XP_010469305.1| PREDICTED: 60S ribosomal protein L38-like [C... 57 5e-06 ref|XP_010101237.1| 60S ribosomal protein L38 [Morus notabilis] ... 56 8e-06 gb|KHN33292.1| 60S ribosomal protein L38 [Glycine soja] 56 8e-06 ref|XP_006595070.1| PREDICTED: 60S ribosomal protein L38 isoform... 56 8e-06 ref|XP_004507352.1| PREDICTED: 60S ribosomal protein L38 isoform... 56 8e-06 ref|XP_007221755.1| hypothetical protein PRUPE_ppb023080mg [Prun... 56 8e-06 tpg|DAA48324.1| TPA: hypothetical protein ZEAMMB73_262778, parti... 56 8e-06 >ref|XP_008664452.1| PREDICTED: uncharacterized protein LOC103643066 [Zea mays] Length = 178 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 110 YSFVFFYDAQPKQIHEIKDFLLTARRKDARSVKIKR 3 YS + Y+ PKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 101 YSALVLYNLCPKQIHEIKDFLLTARRKDARSVKIKR 136 >tpg|DAA48328.1| TPA: hypothetical protein ZEAMMB73_262778, partial [Zea mays] Length = 165 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 110 YSFVFFYDAQPKQIHEIKDFLLTARRKDARSVKIKR 3 YS + Y+ PKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 88 YSALVLYNLCPKQIHEIKDFLLTARRKDARSVKIKR 123 >ref|XP_012472494.1| PREDICTED: 60S ribosomal protein L38-like [Gossypium raimondii] gi|763752457|gb|KJB19845.1| hypothetical protein B456_003G121300 [Gossypium raimondii] Length = 126 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 110 YSFVFFYDAQPKQIHEIKDFLLTARRKDARSVKIKR 3 +SF F+ + +PKQIHEIKDFLLTARRKDA SVKIK+ Sbjct: 52 FSFKFYINLEPKQIHEIKDFLLTARRKDACSVKIKK 87 >ref|XP_002514807.1| 60S ribosomal protein L38, putative [Ricinus communis] gi|223545858|gb|EEF47361.1| 60S ribosomal protein L38, putative [Ricinus communis] Length = 78 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -2 Query: 104 FVFFYDAQPKQIHEIKDFLLTARRKDARSVKIKR 3 F + QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 3 FALLSNLQPKQIHEIKDFLLTARRKDARSVKIKR 36 >ref|XP_010469305.1| PREDICTED: 60S ribosomal protein L38-like [Camelina sativa] Length = 81 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -2 Query: 104 FVFFYDAQPKQIHEIKDFLLTARRKDARSVKIKR 3 F F QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 6 FFDFGCVQPKQIHEIKDFLLTARRKDARSVKIKR 39 >ref|XP_010101237.1| 60S ribosomal protein L38 [Morus notabilis] gi|587899767|gb|EXB88161.1| 60S ribosomal protein L38 [Morus notabilis] Length = 157 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -2 Query: 110 YSFVFFYDAQPKQIHEIKDFLLTARRKDARSVKIKR 3 Y+F PKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 50 YNFGHVNQMPPKQIHEIKDFLLTARRKDARSVKIKR 85 >gb|KHN33292.1| 60S ribosomal protein L38 [Glycine soja] Length = 79 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 83 QPKQIHEIKDFLLTARRKDARSVKIKR 3 QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 2 QPKQIHEIKDFLLTARRKDARSVKIKR 28 >ref|XP_006595070.1| PREDICTED: 60S ribosomal protein L38 isoform X2 [Glycine max] gi|571515197|ref|XP_006597216.1| PREDICTED: 60S ribosomal protein L38-like isoform X1 [Glycine max] Length = 70 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 83 QPKQIHEIKDFLLTARRKDARSVKIKR 3 QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 2 QPKQIHEIKDFLLTARRKDARSVKIKR 28 >ref|XP_004507352.1| PREDICTED: 60S ribosomal protein L38 isoform X1 [Cicer arietinum] Length = 70 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 83 QPKQIHEIKDFLLTARRKDARSVKIKR 3 QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 2 QPKQIHEIKDFLLTARRKDARSVKIKR 28 >ref|XP_007221755.1| hypothetical protein PRUPE_ppb023080mg [Prunus persica] gi|462418691|gb|EMJ22954.1| hypothetical protein PRUPE_ppb023080mg [Prunus persica] Length = 81 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 83 QPKQIHEIKDFLLTARRKDARSVKIKR 3 QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 9 QPKQIHEIKDFLLTARRKDARSVKIKR 35 >tpg|DAA48324.1| TPA: hypothetical protein ZEAMMB73_262778, partial [Zea mays] Length = 84 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 83 QPKQIHEIKDFLLTARRKDARSVKIKR 3 QPKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 16 QPKQIHEIKDFLLTARRKDARSVKIKR 42