BLASTX nr result
ID: Forsythia22_contig00045896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00045896 (444 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65491.1| hypothetical protein VITISV_003157 [Vitis vinifera] 83 3e-15 >emb|CAN65491.1| hypothetical protein VITISV_003157 [Vitis vinifera] Length = 1242 Score = 82.8 bits (203), Expect(2) = 3e-15 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = -1 Query: 180 ELRVYTMSMFNSNTENNLVNLEHGQS*PPISQSPRNLPMDYTHLLISDLDIPIAI 16 ELRVYT FNSNTENN VNLEHGQS P SQ+P NLPMD T L ISDLDIPIAI Sbjct: 1188 ELRVYTRCRFNSNTENNQVNLEHGQSSTPSSQNPDNLPMDSTPLPISDLDIPIAI 1242 Score = 25.4 bits (54), Expect(2) = 3e-15 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 263 KWGSSDLSMPNKIVSQTGGETLQSMS 186 K S L P ++Q+GGETLQ MS Sbjct: 1161 KPASPTLGTPIASLAQSGGETLQPMS 1186