BLASTX nr result
ID: Forsythia22_contig00045741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00045741 (563 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075828.1| PREDICTED: aluminum-activated malate transpo... 72 1e-10 ref|XP_004297128.1| PREDICTED: aluminum-activated malate transpo... 56 9e-06 >ref|XP_011075828.1| PREDICTED: aluminum-activated malate transporter 4-like [Sesamum indicum] Length = 582 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -3 Query: 561 ARLQNLVDSFEVLSEKAKYKEPIVSTETKEVSGFWDSFLKRICCKD 424 ARLQNLV+SFE LSEKA++ EP+ STETK V GFW LKRICCKD Sbjct: 537 ARLQNLVNSFEELSEKAQFSEPVDSTETKVVVGFWAKLLKRICCKD 582 >ref|XP_004297128.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria vesca subsp. vesca] gi|764573974|ref|XP_011462925.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria vesca subsp. vesca] gi|764573978|ref|XP_011462926.1| PREDICTED: aluminum-activated malate transporter 4 [Fragaria vesca subsp. vesca] Length = 583 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/45 (60%), Positives = 32/45 (71%) Frame = -3 Query: 561 ARLQNLVDSFEVLSEKAKYKEPIVSTETKEVSGFWDSFLKRICCK 427 ARLQNLVD F LSEKA +K+P+ S+ETKEV GFW +R K Sbjct: 534 ARLQNLVDEFVELSEKANFKDPMDSSETKEVGGFWTRIYRRFRSK 578