BLASTX nr result
ID: Forsythia22_contig00044861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00044861 (446 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083079.1| PREDICTED: tobamovirus multiplication protei... 58 2e-06 ref|XP_009771731.1| PREDICTED: tobamovirus multiplication protei... 58 2e-06 ref|XP_009771730.1| PREDICTED: tobamovirus multiplication protei... 58 2e-06 ref|XP_009771729.1| PREDICTED: tobamovirus multiplication protei... 58 2e-06 ref|XP_009771728.1| PREDICTED: tobamovirus multiplication protei... 58 2e-06 ref|XP_009612633.1| PREDICTED: tobamovirus multiplication protei... 58 2e-06 ref|XP_012837039.1| PREDICTED: tobamovirus multiplication protei... 57 4e-06 ref|XP_006361173.1| PREDICTED: tobamovirus multiplication protei... 57 5e-06 ref|XP_009791201.1| PREDICTED: tobamovirus multiplication protei... 57 6e-06 >ref|XP_011083079.1| PREDICTED: tobamovirus multiplication protein 2B [Sesamum indicum] Length = 136 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 186 KEGSTKTIVADQISQSVQSTSNLLHLMLQSSPSH 85 ++ S K IVADQISQSVQSTSNLLHLMLQSSPSH Sbjct: 10 RKESAKAIVADQISQSVQSTSNLLHLMLQSSPSH 43 >ref|XP_009771731.1| PREDICTED: tobamovirus multiplication protein 2B isoform X4 [Nicotiana sylvestris] Length = 132 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPS 88 +++GS KT+VADQI+QS+QSTSNLLHLMLQSSPS Sbjct: 16 SRDGSAKTMVADQITQSIQSTSNLLHLMLQSSPS 49 >ref|XP_009771730.1| PREDICTED: tobamovirus multiplication protein 2B isoform X3 [Nicotiana sylvestris] Length = 133 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPS 88 +++GS KT+VADQI+QS+QSTSNLLHLMLQSSPS Sbjct: 16 SRDGSAKTMVADQITQSIQSTSNLLHLMLQSSPS 49 >ref|XP_009771729.1| PREDICTED: tobamovirus multiplication protein 2B isoform X2 [Nicotiana sylvestris] Length = 146 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPS 88 +++GS KT+VADQI+QS+QSTSNLLHLMLQSSPS Sbjct: 16 SRDGSAKTMVADQITQSIQSTSNLLHLMLQSSPS 49 >ref|XP_009771728.1| PREDICTED: tobamovirus multiplication protein 2B isoform X1 [Nicotiana sylvestris] Length = 151 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPS 88 +++GS KT+VADQI+QS+QSTSNLLHLMLQSSPS Sbjct: 16 SRDGSAKTMVADQITQSIQSTSNLLHLMLQSSPS 49 >ref|XP_009612633.1| PREDICTED: tobamovirus multiplication protein 2B [Nicotiana tomentosiformis] Length = 134 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPS 88 +++GS KT+VADQI+QS+QSTSNLLHLMLQSSPS Sbjct: 14 SRDGSAKTMVADQITQSIQSTSNLLHLMLQSSPS 47 >ref|XP_012837039.1| PREDICTED: tobamovirus multiplication protein 2B [Erythranthe guttatus] gi|604348224|gb|EYU46379.1| hypothetical protein MIMGU_mgv1a016133mg [Erythranthe guttata] Length = 133 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 186 KEGSTKTIVADQISQSVQSTSNLLHLMLQSSPSH 85 +EGS K VADQISQSVQSTSN+LHLMLQ+SP+H Sbjct: 11 REGSAKASVADQISQSVQSTSNILHLMLQTSPAH 44 >ref|XP_006361173.1| PREDICTED: tobamovirus multiplication protein 2B-like [Solanum tuberosum] Length = 136 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPS 88 +++G+ KT+VADQI+QS+QSTSNLLHLMLQSSPS Sbjct: 13 SRDGTAKTMVADQITQSIQSTSNLLHLMLQSSPS 46 >ref|XP_009791201.1| PREDICTED: tobamovirus multiplication protein 2B-like [Nicotiana sylvestris] Length = 89 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 189 NKEGSTKTIVADQISQSVQSTSNLLHLMLQSSPSHVL 79 +++GSTKT+VADQI+QS+QSTSNLLHLMLQSS + VL Sbjct: 37 SRDGSTKTMVADQITQSIQSTSNLLHLMLQSSFALVL 73