BLASTX nr result
ID: Forsythia22_contig00044851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00044851 (907 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 97 2e-17 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 80 2e-12 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 97.1 bits (240), Expect = 2e-17 Identities = 54/70 (77%), Positives = 55/70 (78%), Gaps = 5/70 (7%) Frame = +2 Query: 158 MAKLVDATDLIGLSLGMETY*VVTFKFRETPELIKMGNPEPNPVFPKQ-----RFRKKKR 322 MA+LVDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP F KQ KKR Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQINKSLESENKKR 59 Query: 323 IGAETQWKLF 352 IGAETQWKLF Sbjct: 60 IGAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] Length = 95 Score = 79.7 bits (195), Expect = 2e-12 Identities = 46/62 (74%), Positives = 47/62 (75%), Gaps = 5/62 (8%) Frame = +2 Query: 158 MAKLVDATDLIGLSLGMETY*VVTFKFRETPELIKMGNPEPNPVFPKQ-----RFRKKKR 322 MAKLVDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP F KQ +KR Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQINKSLESENQKR 59 Query: 323 IG 328 IG Sbjct: 60 IG 61