BLASTX nr result
ID: Forsythia22_contig00044777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00044777 (614 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073190.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partia... 69 1e-09 emb|CDP19762.1| unnamed protein product [Coffea canephora] 59 1e-06 >ref|XP_011073190.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61990, mitochondrial [Sesamum indicum] Length = 1035 Score = 70.1 bits (170), Expect = 8e-10 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = -2 Query: 613 YKPSLATCSTLVCSLNQSGYVEK-LAKVLDIMVKFGWVPKSMSLDELIIQSHMGDSEKSS 437 YKPS+ TC TL L + GY E+ L KV D+MV FGWVP S+SL++LIIQ GD E S Sbjct: 962 YKPSVTTCGTLAYGLKRIGYKEEELDKVFDVMVSFGWVPSSLSLNDLIIQYQPGDLEIGS 1021 Query: 436 DLS 428 D S Sbjct: 1022 DQS 1024 >gb|EYU21817.1| hypothetical protein MIMGU_mgv1a0008302mg, partial [Erythranthe guttata] Length = 142 Score = 69.3 bits (168), Expect = 1e-09 Identities = 34/63 (53%), Positives = 46/63 (73%) Frame = -2 Query: 613 YKPSLATCSTLVCSLNQSGYVEKLAKVLDIMVKFGWVPKSMSLDELIIQSHMGDSEKSSD 434 YKPS+ATC TL L + GY E + KVLD+MV+FGWVP SMSL++LI Q G+ + ++ Sbjct: 71 YKPSVATCGTLAYGLKRVGYKE-VDKVLDVMVRFGWVPPSMSLNDLIGQYQRGNLDSKNE 129 Query: 433 LSG 425 +SG Sbjct: 130 VSG 132 >emb|CDP19762.1| unnamed protein product [Coffea canephora] Length = 1035 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/63 (46%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 613 YKPSLATCSTLVCSLNQSGYVEKLAKVLDIMVKFGWVPKSMSLDELI-IQSHMGDSEKSS 437 Y P LA CSTL+ LN++GY +L K+L+IM +GW+PK +L+E I + +SE S Sbjct: 962 YNPCLAMCSTLIHGLNKAGYSRRLDKILEIMKGYGWIPKCTALNEFIDLYQISANSESVS 1021 Query: 436 DLS 428 +LS Sbjct: 1022 NLS 1024