BLASTX nr result
ID: Forsythia22_contig00044741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00044741 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208904.1| hypothetical protein PRUPE_ppa026988mg [Prun... 57 4e-06 ref|XP_007213398.1| hypothetical protein PRUPE_ppa026428mg [Prun... 57 6e-06 >ref|XP_007208904.1| hypothetical protein PRUPE_ppa026988mg [Prunus persica] gi|462404639|gb|EMJ10103.1| hypothetical protein PRUPE_ppa026988mg [Prunus persica] Length = 533 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +3 Query: 93 GKRKSSRKTSEVWDHFTIIG-DPNAEDVRCECKYCEQSYACDAKKCGTS 236 GKRK + S VWDHFT I D + RC CKYC++ YACD K+ TS Sbjct: 38 GKRKPCKNASGVWDHFTEIKCDDETSESRCICKYCKKDYACDGKRNATS 86 >ref|XP_007213398.1| hypothetical protein PRUPE_ppa026428mg [Prunus persica] gi|462409263|gb|EMJ14597.1| hypothetical protein PRUPE_ppa026428mg [Prunus persica] Length = 517 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +3 Query: 93 GKRKSSRKTSEVWDHFTIIG-DPNAEDVRCECKYCEQSYACDAKKCGTS 236 GKR+ S+ S VWDH T I + + RC CKYC++ YACD K+ GTS Sbjct: 24 GKRRPSKNASGVWDHLTKIKCEDETSESRCICKYCKKDYACDGKRNGTS 72