BLASTX nr result
ID: Forsythia22_contig00044621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00044621 (308 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009602798.1| PREDICTED: ubiquitin-like domain-containing ... 57 4e-06 ref|XP_007159568.1| hypothetical protein PHAVU_002G248400g [Phas... 57 6e-06 ref|XP_009776066.1| PREDICTED: ubiquitin-like domain-containing ... 56 8e-06 >ref|XP_009602798.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Nicotiana tomentosiformis] Length = 336 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 307 ELVKLTQYLLGIAAFDDLGILDHKHWEIFSEYNLKRSGH 191 EL+KLTQYLL IA DDL +LDHK+WE F+E N KR H Sbjct: 297 ELMKLTQYLLAIADLDDLSVLDHKNWESFNEDNFKRRRH 335 >ref|XP_007159568.1| hypothetical protein PHAVU_002G248400g [Phaseolus vulgaris] gi|561032983|gb|ESW31562.1| hypothetical protein PHAVU_002G248400g [Phaseolus vulgaris] Length = 333 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -2 Query: 307 ELVKLTQYLLGIAAFDDLGILDHKHWEIFSEYNLKRSGH 191 ELVKLTQYLL IA FDDL LDH WE+F+E N KR H Sbjct: 294 ELVKLTQYLLAIAEFDDLSNLDHYKWELFTEDNAKRRRH 332 >ref|XP_009776066.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Nicotiana sylvestris] Length = 336 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -2 Query: 307 ELVKLTQYLLGIAAFDDLGILDHKHWEIFSEYNLKRSGH 191 EL+KLTQYLL IA DDL LDHK+WE F+E N KR H Sbjct: 297 ELMKLTQYLLAIADLDDLSFLDHKNWESFNEDNFKRRRH 335