BLASTX nr result
ID: Forsythia22_contig00044520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00044520 (473 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849390.1| PREDICTED: adenosine deaminase-like protein ... 59 2e-06 >ref|XP_012849390.1| PREDICTED: adenosine deaminase-like protein [Erythranthe guttatus] gi|604315109|gb|EYU27815.1| hypothetical protein MIMGU_mgv1a008719mg [Erythranthe guttata] Length = 364 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 92 LQVEICLTSNIITETISSVDVHHFADLYKS 3 + VEICLTSNIITETI+SVDVHHFADLYKS Sbjct: 264 IPVEICLTSNIITETIASVDVHHFADLYKS 293