BLASTX nr result
ID: Forsythia22_contig00043453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043453 (447 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092392.1| PREDICTED: WAT1-related protein At1g25270-li... 66 8e-09 >ref|XP_011092392.1| PREDICTED: WAT1-related protein At1g25270-like [Sesamum indicum] Length = 414 Score = 66.2 bits (160), Expect = 8e-09 Identities = 34/66 (51%), Positives = 48/66 (72%), Gaps = 2/66 (3%) Frame = +3 Query: 6 IIVLGLYTVLWGKSKEIKRISPLMPRKSFNEA--DQTDNIPSESIKIDHCSNMIMANAPS 179 II+ GLY+VLWGKSKE+K+I+ L+P KSF EA + + ES K + +N ++A AP+ Sbjct: 322 IIICGLYSVLWGKSKEMKKITRLVPSKSFTEATHHEVEETARESFKGFNHANNVVAVAPN 381 Query: 180 FLPETE 197 FLPE+E Sbjct: 382 FLPESE 387