BLASTX nr result
ID: Forsythia22_contig00043296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043296 (721 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009598444.1| PREDICTED: serine/arginine-rich splicing fac... 64 7e-08 ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing fac... 60 1e-06 >ref|XP_009598444.1| PREDICTED: serine/arginine-rich splicing factor RS41-like isoform X1 [Nicotiana tomentosiformis] Length = 283 Score = 64.3 bits (155), Expect = 7e-08 Identities = 32/45 (71%), Positives = 34/45 (75%) Frame = +2 Query: 362 MVLQSYTSLGP*PFAFFMILLSPQFPTCFNIDFMFISDPVAGVVF 496 MVLQSY+ L P PFAF M LLSP + TCFNID M ISDPVA V F Sbjct: 1 MVLQSYSLLRPLPFAFLMTLLSPHYLTCFNIDSMIISDPVAAVEF 45 >ref|XP_012843655.1| PREDICTED: serine/arginine-rich splicing factor RS40-like isoform X1 [Erythranthe guttatus] Length = 259 Score = 60.5 bits (145), Expect = 1e-06 Identities = 31/45 (68%), Positives = 31/45 (68%) Frame = +2 Query: 362 MVLQSYTSLGP*PFAFFMILLSPQFPTCFNIDFMFISDPVAGVVF 496 MV SYT L PFAF M L S QFPTCFNID MFI DPVAG F Sbjct: 1 MVPPSYTFLRSLPFAFLMTLHSLQFPTCFNIDIMFIPDPVAGFAF 45