BLASTX nr result
ID: Forsythia22_contig00043014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043014 (334 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006347118.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 68 2e-09 ref|XP_004232812.2| PREDICTED: LOW QUALITY PROTEIN: thiosulfate/... 67 5e-09 gb|ACN58229.1| thiosulfate:cyanide sulfurtransferase-like protei... 67 5e-09 emb|CAD27691.1| rhodanese [Solanum lycopersicum] 67 5e-09 ref|XP_009777861.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 65 2e-08 gb|KJB83963.1| hypothetical protein B456_013G142500 [Gossypium r... 64 3e-08 ref|XP_012463200.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 64 3e-08 ref|XP_012463201.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 64 3e-08 ref|XP_012841877.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 64 3e-08 ref|XP_004488787.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 64 3e-08 ref|XP_006416816.1| hypothetical protein EUTSA_v10007910mg [Eutr... 64 5e-08 ref|XP_006416815.1| hypothetical protein EUTSA_v10007910mg [Eutr... 64 5e-08 ref|XP_010472768.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 ref|XP_010472766.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 ref|XP_010429795.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 ref|XP_010429794.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 ref|XP_010417544.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 ref|XP_010417543.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 ref|XP_009106646.1| PREDICTED: thiosulfate/3-mercaptopyruvate su... 63 7e-08 emb|CDX87398.1| BnaA07g34750D [Brassica napus] 63 7e-08 >ref|XP_006347118.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like [Solanum tuberosum] Length = 318 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTPDNT 228 CILVLGLHRLGKT++PVYDGSWTEWAT+ DTP +T Sbjct: 281 CILVLGLHRLGKTDIPVYDGSWTEWATQPDTPLST 315 >ref|XP_004232812.2| PREDICTED: LOW QUALITY PROTEIN: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial [Solanum lycopersicum] Length = 368 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 C+LVLGLHRLGKT++PVYDGSWTEWAT+ DTP Sbjct: 331 CVLVLGLHRLGKTDIPVYDGSWTEWATQPDTP 362 >gb|ACN58229.1| thiosulfate:cyanide sulfurtransferase-like protein [Solanum lycopersicum] Length = 318 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 C+LVLGLHRLGKT++PVYDGSWTEWAT+ DTP Sbjct: 281 CVLVLGLHRLGKTDIPVYDGSWTEWATQPDTP 312 >emb|CAD27691.1| rhodanese [Solanum lycopersicum] Length = 55 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 C+LVLGLHRLGKT++PVYDGSWTEWAT+ DTP Sbjct: 18 CVLVLGLHRLGKTDIPVYDGSWTEWATQPDTP 49 >ref|XP_009777861.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like [Nicotiana sylvestris] Length = 379 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTPDNTCNT 219 CIL LGLHRLGKT+VPVYDGSWTEW DTP +T T Sbjct: 342 CILALGLHRLGKTDVPVYDGSWTEWGAHPDTPVSTSET 379 >gb|KJB83963.1| hypothetical protein B456_013G142500 [Gossypium raimondii] Length = 376 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTPDNT 228 CIL LGLHRLGKT+VPVYDGSWTEW + DTP +T Sbjct: 340 CILALGLHRLGKTDVPVYDGSWTEWGAESDTPVDT 374 >ref|XP_012463200.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial isoform X1 [Gossypium raimondii] gi|763817110|gb|KJB83962.1| hypothetical protein B456_013G142500 [Gossypium raimondii] Length = 378 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTPDNT 228 CIL LGLHRLGKT+VPVYDGSWTEW + DTP +T Sbjct: 342 CILALGLHRLGKTDVPVYDGSWTEWGAESDTPVDT 376 >ref|XP_012463201.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial isoform X2 [Gossypium raimondii] gi|763817109|gb|KJB83961.1| hypothetical protein B456_013G142500 [Gossypium raimondii] Length = 377 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTPDNT 228 CIL LGLHRLGKT+VPVYDGSWTEW + DTP +T Sbjct: 341 CILALGLHRLGKTDVPVYDGSWTEWGAESDTPVDT 375 >ref|XP_012841877.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 2-like [Erythranthe guttatus] gi|604328120|gb|EYU33788.1| hypothetical protein MIMGU_mgv1a008159mg [Erythranthe guttata] gi|604328121|gb|EYU33789.1| hypothetical protein MIMGU_mgv1a008159mg [Erythranthe guttata] Length = 383 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL LGLHRLGKTNVPVYDGSWTEW DTP Sbjct: 346 CILALGLHRLGKTNVPVYDGSWTEWGANPDTP 377 >ref|XP_004488787.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial [Cicer arietinum] Length = 375 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTPDNTCNT 219 CIL LGLHRLGKTNVPVYDGSW+EW + DTP + T Sbjct: 337 CILALGLHRLGKTNVPVYDGSWSEWGAQSDTPVESSQT 374 >ref|XP_006416816.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum] gi|557094587|gb|ESQ35169.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum] Length = 383 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL LGLHRLGKTNVP+YDGSWTEWAT+ + P Sbjct: 346 CILALGLHRLGKTNVPIYDGSWTEWATEPNLP 377 >ref|XP_006416815.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum] gi|557094586|gb|ESQ35168.1| hypothetical protein EUTSA_v10007910mg [Eutrema salsugineum] Length = 320 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL LGLHRLGKTNVP+YDGSWTEWAT+ + P Sbjct: 283 CILALGLHRLGKTNVPIYDGSWTEWATEPNLP 314 >ref|XP_010472768.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like isoform X2 [Camelina sativa] Length = 282 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 243 CILAMGLHRLGKTDVPVYDGSWTEWATQPDLP 274 >ref|XP_010472766.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like isoform X1 [Camelina sativa] gi|727599558|ref|XP_010472767.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like isoform X1 [Camelina sativa] Length = 382 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 343 CILAMGLHRLGKTDVPVYDGSWTEWATQPDLP 374 >ref|XP_010429795.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like isoform X2 [Camelina sativa] Length = 282 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 243 CILAMGLHRLGKTDVPVYDGSWTEWATQPDLP 274 >ref|XP_010429794.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like isoform X1 [Camelina sativa] Length = 383 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 344 CILAMGLHRLGKTDVPVYDGSWTEWATQPDLP 375 >ref|XP_010417544.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial isoform X2 [Camelina sativa] Length = 282 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 243 CILAMGLHRLGKTDVPVYDGSWTEWATQPDLP 274 >ref|XP_010417543.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial isoform X1 [Camelina sativa] Length = 383 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 344 CILAMGLHRLGKTDVPVYDGSWTEWATQPDLP 375 >ref|XP_009106646.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial [Brassica rapa] Length = 375 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 336 CILAMGLHRLGKTDVPVYDGSWTEWATEPDLP 367 >emb|CDX87398.1| BnaA07g34750D [Brassica napus] Length = 375 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 332 CILVLGLHRLGKTNVPVYDGSWTEWATKLDTP 237 CIL +GLHRLGKT+VPVYDGSWTEWAT+ D P Sbjct: 336 CILAMGLHRLGKTDVPVYDGSWTEWATEPDLP 367