BLASTX nr result
ID: Forsythia22_contig00042786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00042786 (595 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070368.1| PREDICTED: zinc finger HIT domain-containing... 119 1e-24 ref|XP_009793281.1| PREDICTED: zinc finger HIT domain-containing... 100 9e-19 ref|XP_009793280.1| PREDICTED: zinc finger HIT domain-containing... 100 9e-19 ref|XP_004245472.1| PREDICTED: zinc finger HIT domain-containing... 100 9e-19 gb|KDO86089.1| hypothetical protein CISIN_1g035529mg [Citrus sin... 99 1e-18 ref|XP_006343799.1| PREDICTED: zinc finger HIT domain-containing... 99 1e-18 ref|XP_006445091.1| hypothetical protein CICLE_v10020379mg [Citr... 99 1e-18 ref|XP_012851339.1| PREDICTED: zinc finger HIT domain-containing... 98 3e-18 gb|EYU25799.1| hypothetical protein MIMGU_mgv1a009842mg [Erythra... 98 3e-18 ref|XP_010106140.1| hypothetical protein L484_003644 [Morus nota... 95 3e-17 ref|XP_010659870.1| PREDICTED: zinc finger HIT domain-containing... 94 6e-17 ref|XP_009612745.1| PREDICTED: zinc finger HIT domain-containing... 94 6e-17 gb|KEH40602.1| HIT zinc finger protein [Medicago truncatula] 94 6e-17 ref|XP_003637663.1| hypothetical protein MTR_097s0007 [Medicago ... 94 6e-17 ref|XP_002273095.1| PREDICTED: zinc finger HIT domain-containing... 94 6e-17 emb|CAN74601.1| hypothetical protein VITISV_028111 [Vitis vinifera] 94 6e-17 ref|XP_007039436.1| HIT-type Zinc finger family protein [Theobro... 92 2e-16 ref|XP_004297114.1| PREDICTED: zinc finger HIT domain-containing... 91 4e-16 ref|XP_007209196.1| hypothetical protein PRUPE_ppa006441mg [Prun... 91 5e-16 ref|XP_002303681.1| hypothetical protein POPTR_0003s14500g [Popu... 90 7e-16 >ref|XP_011070368.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Sesamum indicum] gi|747048701|ref|XP_011070369.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Sesamum indicum] Length = 412 Score = 119 bits (297), Expect = 1e-24 Identities = 59/81 (72%), Positives = 72/81 (88%), Gaps = 1/81 (1%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEKL+KSKR E+K+KL+SAERKVYF+MCWV+EQP+E SSLAA+VN EKSSA+EFA SK+ Sbjct: 332 SEKLYKSKRAELKSKLRSAERKVYFMMCWVYEQPSEAWSSLAAIVNTEKSSAMEFADSKR 391 Query: 415 GTVR-SEKVERTGKPLIEEVQ 356 TVR EK ER+GKPLI+EV+ Sbjct: 392 STVRMEEKTERSGKPLIKEVK 412 >ref|XP_009793281.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X2 [Nicotiana sylvestris] Length = 348 Score = 99.8 bits (247), Expect = 9e-19 Identities = 50/80 (62%), Positives = 58/80 (72%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KS+ EIK KLKSAERKVYFIMCW HEQP E SSLAA+V AEKS V+ SK Sbjct: 269 SEKPRKSRSSEIKTKLKSAERKVYFIMCWAHEQPREAWSSLAAIVEAEKSRLVDVIGSKT 328 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + EKV+ GKPLI+E++ Sbjct: 329 NLPKMEKVQNEGKPLIKEIE 348 >ref|XP_009793280.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X1 [Nicotiana sylvestris] Length = 409 Score = 99.8 bits (247), Expect = 9e-19 Identities = 50/80 (62%), Positives = 58/80 (72%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KS+ EIK KLKSAERKVYFIMCW HEQP E SSLAA+V AEKS V+ SK Sbjct: 330 SEKPRKSRSSEIKTKLKSAERKVYFIMCWAHEQPREAWSSLAAIVEAEKSRLVDVIGSKT 389 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + EKV+ GKPLI+E++ Sbjct: 390 NLPKMEKVQNEGKPLIKEIE 409 >ref|XP_004245472.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Solanum lycopersicum] Length = 409 Score = 99.8 bits (247), Expect = 9e-19 Identities = 50/80 (62%), Positives = 58/80 (72%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KSK E+K KLKSAERKVYFIMCW HEQP E SS+AA+V AEKS VEF SK Sbjct: 330 SEKYCKSKSSEMKTKLKSAERKVYFIMCWAHEQPKEAWSSIAAIVEAEKSRLVEFVGSKT 389 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + KV+ G+PLI+EV+ Sbjct: 390 SVPKMTKVQSEGRPLIKEVE 409 >gb|KDO86089.1| hypothetical protein CISIN_1g035529mg [Citrus sinensis] Length = 394 Score = 99.4 bits (246), Expect = 1e-18 Identities = 49/79 (62%), Positives = 58/79 (73%) Frame = -1 Query: 592 EKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKKG 413 EK KS++VE+KNKLK AERK+YFIMCWVHEQP EV SS AAL+ AEK S +E SK Sbjct: 316 EKTKKSRKVEMKNKLKPAERKIYFIMCWVHEQPGEVWSSAAALLRAEKISCIECGGSKSS 375 Query: 412 TVRSEKVERTGKPLIEEVQ 356 R +KVE K LIEE++ Sbjct: 376 VKREDKVESKSKVLIEEMK 394 >ref|XP_006343799.1| PREDICTED: zinc finger HIT domain-containing protein 2-like [Solanum tuberosum] Length = 409 Score = 99.4 bits (246), Expect = 1e-18 Identities = 50/80 (62%), Positives = 57/80 (71%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SE KSK EIK KLK AERKVYFIMCW HEQP E SS+AA+V AEKS VEF SK Sbjct: 330 SENSRKSKSSEIKTKLKFAERKVYFIMCWAHEQPQEAWSSIAAMVEAEKSRLVEFIGSKT 389 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + +KV+ GKPLI+EV+ Sbjct: 390 SVPKMKKVQNEGKPLIKEVE 409 >ref|XP_006445091.1| hypothetical protein CICLE_v10020379mg [Citrus clementina] gi|568875963|ref|XP_006491057.1| PREDICTED: zinc finger HIT domain-containing protein 2-like isoform X1 [Citrus sinensis] gi|568875965|ref|XP_006491058.1| PREDICTED: zinc finger HIT domain-containing protein 2-like isoform X2 [Citrus sinensis] gi|557547353|gb|ESR58331.1| hypothetical protein CICLE_v10020379mg [Citrus clementina] Length = 411 Score = 99.4 bits (246), Expect = 1e-18 Identities = 49/79 (62%), Positives = 58/79 (73%) Frame = -1 Query: 592 EKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKKG 413 EK KS++VE+KNKLK AERK+YFIMCWVHEQP EV SS AAL+ AEK S +E SK Sbjct: 333 EKTKKSRKVEMKNKLKPAERKIYFIMCWVHEQPGEVWSSAAALLRAEKISCIECGGSKSS 392 Query: 412 TVRSEKVERTGKPLIEEVQ 356 R +KVE K LIEE++ Sbjct: 393 VKREDKVESKSKVLIEEMK 411 >ref|XP_012851339.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Erythranthe guttatus] Length = 411 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/80 (56%), Positives = 61/80 (76%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK+ KSKR E+K KLKS +RKVYF+MCWVHEQP E +SLA +V+ EK +A+E+A +K+ Sbjct: 332 SEKMRKSKRAELKGKLKSVDRKVYFMMCWVHEQPLEAWASLARIVDIEKRTAMEYADAKR 391 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 R + + GKPLI+E+Q Sbjct: 392 SDARVVEKKERGKPLIKEIQ 411 >gb|EYU25799.1| hypothetical protein MIMGU_mgv1a009842mg [Erythranthe guttata] Length = 329 Score = 98.2 bits (243), Expect = 3e-18 Identities = 45/80 (56%), Positives = 61/80 (76%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK+ KSKR E+K KLKS +RKVYF+MCWVHEQP E +SLA +V+ EK +A+E+A +K+ Sbjct: 250 SEKMRKSKRAELKGKLKSVDRKVYFMMCWVHEQPLEAWASLARIVDIEKRTAMEYADAKR 309 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 R + + GKPLI+E+Q Sbjct: 310 SDARVVEKKERGKPLIKEIQ 329 >ref|XP_010106140.1| hypothetical protein L484_003644 [Morus notabilis] gi|587920496|gb|EXC07934.1| hypothetical protein L484_003644 [Morus notabilis] Length = 407 Score = 94.7 bits (234), Expect = 3e-17 Identities = 46/80 (57%), Positives = 62/80 (77%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEKL KS+++EIKNKLK AERK+YFIMCWVH+QP E SSLAA+V AEK+SA+++ + + Sbjct: 330 SEKLQKSRKLEIKNKLKLAERKIYFIMCWVHDQPGEAWSSLAAIVRAEKASAMDYINISR 389 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 +K E GK LI+E++ Sbjct: 390 KV--EKKAENRGKVLIQEME 407 >ref|XP_010659870.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X2 [Vitis vinifera] Length = 363 Score = 93.6 bits (231), Expect = 6e-17 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = -1 Query: 589 KLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKKGT 410 K KSKR +I++KLK AERK+YFIMCWVHEQP E SSLAA+V EK S ++FA+S++ Sbjct: 286 KPRKSKRPDIRSKLKLAERKIYFIMCWVHEQPDEAWSSLAAIVKTEKGSTMDFAASQRSV 345 Query: 409 VRSEKVERTGKPLIEEVQ 356 +K + GK LIEEVQ Sbjct: 346 KMEDKSKSRGKILIEEVQ 363 >ref|XP_009612745.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Nicotiana tomentosiformis] Length = 409 Score = 93.6 bits (231), Expect = 6e-17 Identities = 46/80 (57%), Positives = 57/80 (71%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KS+ EI+ KLKSAERKVYF+MCW HEQ E SSLAA+V AEKS ++ SK Sbjct: 330 SEKPRKSRSSEIRTKLKSAERKVYFLMCWAHEQSREAWSSLAAIVEAEKSRLMDVIGSKT 389 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + EKV+ GKPLI+E++ Sbjct: 390 SLPKMEKVQNEGKPLIKEIE 409 >gb|KEH40602.1| HIT zinc finger protein [Medicago truncatula] Length = 405 Score = 93.6 bits (231), Expect = 6e-17 Identities = 49/80 (61%), Positives = 60/80 (75%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KS+R EI + +K AERK+YFIMCWVHEQP EVLSSLAA+V A+K+SA+EF S K Sbjct: 327 SEKPKKSRRDEISS-IKQAERKIYFIMCWVHEQPDEVLSSLAAIVTAQKTSAMEFQGSNK 385 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + K E GK LIEE++ Sbjct: 386 PEKPNNKAESRGKCLIEEIE 405 >ref|XP_003637663.1| hypothetical protein MTR_097s0007 [Medicago truncatula] gi|657401642|gb|KEH40601.1| HIT zinc finger protein [Medicago truncatula] Length = 346 Score = 93.6 bits (231), Expect = 6e-17 Identities = 49/80 (61%), Positives = 60/80 (75%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KS+R EI + +K AERK+YFIMCWVHEQP EVLSSLAA+V A+K+SA+EF S K Sbjct: 268 SEKPKKSRRDEISS-IKQAERKIYFIMCWVHEQPDEVLSSLAAIVTAQKTSAMEFQGSNK 326 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 + K E GK LIEE++ Sbjct: 327 PEKPNNKAESRGKCLIEEIE 346 >ref|XP_002273095.1| PREDICTED: zinc finger HIT domain-containing protein 2 isoform X1 [Vitis vinifera] gi|297742416|emb|CBI34565.3| unnamed protein product [Vitis vinifera] Length = 409 Score = 93.6 bits (231), Expect = 6e-17 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = -1 Query: 589 KLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKKGT 410 K KSKR +I++KLK AERK+YFIMCWVHEQP E SSLAA+V EK S ++FA+S++ Sbjct: 332 KPRKSKRPDIRSKLKLAERKIYFIMCWVHEQPDEAWSSLAAIVKTEKGSTMDFAASQRSV 391 Query: 409 VRSEKVERTGKPLIEEVQ 356 +K + GK LIEEVQ Sbjct: 392 KMEDKSKSRGKILIEEVQ 409 >emb|CAN74601.1| hypothetical protein VITISV_028111 [Vitis vinifera] Length = 843 Score = 93.6 bits (231), Expect = 6e-17 Identities = 46/78 (58%), Positives = 58/78 (74%) Frame = -1 Query: 589 KLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKKGT 410 K KSKR +I++KLK AERK+YFIMCWVHEQP E SSLAA+V EK S ++FA+S++ Sbjct: 766 KPRKSKRPDIRSKLKLAERKIYFIMCWVHEQPDEAWSSLAAIVKTEKGSTMDFAASQRSV 825 Query: 409 VRSEKVERTGKPLIEEVQ 356 +K + GK LIEEVQ Sbjct: 826 KMEDKSKSRGKILIEEVQ 843 >ref|XP_007039436.1| HIT-type Zinc finger family protein [Theobroma cacao] gi|508776681|gb|EOY23937.1| HIT-type Zinc finger family protein [Theobroma cacao] Length = 410 Score = 91.7 bits (226), Expect = 2e-16 Identities = 46/79 (58%), Positives = 56/79 (70%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK ++ EIK+KLK AERKV+FIMCWVHEQP E SSL A+V AEKSS +++ SK Sbjct: 332 SEKPRMLRKAEIKSKLKLAERKVHFIMCWVHEQPGEAWSSLGAMVKAEKSSFMDYGGSKS 391 Query: 415 GTVRSEKVERTGKPLIEEV 359 + R K E GK LIEE+ Sbjct: 392 FSKRENKAENKGKVLIEEM 410 >ref|XP_004297114.1| PREDICTED: zinc finger HIT domain-containing protein 2 [Fragaria vesca subsp. vesca] Length = 415 Score = 90.9 bits (224), Expect = 4e-16 Identities = 45/80 (56%), Positives = 56/80 (70%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 SEK KS+RVEI++KLK AERK+YF+MCWVHEQP E SSL A+V AEKSSA+ + + Sbjct: 334 SEKPRKSRRVEIRSKLKQAERKIYFLMCWVHEQPGEAWSSLGAIVRAEKSSAMNYEAVSL 393 Query: 415 GTVRSEKVERTGKPLIEEVQ 356 K E K LIEE++ Sbjct: 394 SHKPDNKPEPRSKALIEEIK 413 >ref|XP_007209196.1| hypothetical protein PRUPE_ppa006441mg [Prunus persica] gi|462404931|gb|EMJ10395.1| hypothetical protein PRUPE_ppa006441mg [Prunus persica] Length = 412 Score = 90.5 bits (223), Expect = 5e-16 Identities = 49/82 (59%), Positives = 61/82 (74%), Gaps = 2/82 (2%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAV--EFASS 422 SEK KS+R EI++KLK AERK+YFIMCWVHEQP E SSLAA+V AEK SA+ E A+S Sbjct: 332 SEKPRKSRRAEIRSKLKVAERKIYFIMCWVHEQPGEAWSSLAAIVKAEKGSALNYEAAAS 391 Query: 421 KKGTVRSEKVERTGKPLIEEVQ 356 + G V +K E K LI+E++ Sbjct: 392 RPGKV-DKKAEPRSKVLIQEIK 412 >ref|XP_002303681.1| hypothetical protein POPTR_0003s14500g [Populus trichocarpa] gi|222841113|gb|EEE78660.1| hypothetical protein POPTR_0003s14500g [Populus trichocarpa] Length = 416 Score = 90.1 bits (222), Expect = 7e-16 Identities = 48/79 (60%), Positives = 57/79 (72%) Frame = -1 Query: 595 SEKLHKSKRVEIKNKLKSAERKVYFIMCWVHEQPAEVLSSLAALVNAEKSSAVEFASSKK 416 +EK KSK EIK+KLK AE+KVYFIMCWVHEQP E SSLAA+V AEKSSA++ + K Sbjct: 339 AEKKRKSK-TEIKSKLKLAEKKVYFIMCWVHEQPGEAWSSLAAIVRAEKSSALDCRAGKN 397 Query: 415 GTVRSEKVERTGKPLIEEV 359 + K E GK LIEE+ Sbjct: 398 PQIAELKTESKGKVLIEEL 416