BLASTX nr result
ID: Forsythia22_contig00041964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00041964 (185 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095170.1| PREDICTED: proteoglycan 4 [Sesamum indicum] 103 3e-20 ref|XP_007033485.1| Uncharacterized protein isoform 3 [Theobroma... 100 4e-19 ref|XP_007033484.1| Uncharacterized protein isoform 2, partial [... 100 4e-19 ref|XP_006481235.1| PREDICTED: putative GPI-anchored protein PB1... 100 5e-19 ref|XP_010036018.1| PREDICTED: sialidase isoform X1 [Eucalyptus ... 100 6e-19 gb|KCW47541.1| hypothetical protein EUGRSUZ_K01295 [Eucalyptus g... 100 6e-19 gb|KCW47540.1| hypothetical protein EUGRSUZ_K01295 [Eucalyptus g... 100 6e-19 ref|XP_010036019.1| PREDICTED: uncharacterized threonine-rich GP... 100 6e-19 emb|CDP06374.1| unnamed protein product [Coffea canephora] 99 1e-18 gb|KJB27639.1| hypothetical protein B456_005G003100 [Gossypium r... 98 2e-18 ref|XP_012481317.1| PREDICTED: sialidase-like [Gossypium raimond... 98 2e-18 gb|KJB27637.1| hypothetical protein B456_005G003100 [Gossypium r... 98 2e-18 gb|KHG06089.1| Prolactin-3D4 [Gossypium arboreum] 98 2e-18 gb|KDO64168.1| hypothetical protein CISIN_1g008000mg [Citrus sin... 98 2e-18 gb|KDO64167.1| hypothetical protein CISIN_1g008000mg [Citrus sin... 98 2e-18 ref|XP_006429634.1| hypothetical protein CICLE_v100114701mg, par... 98 2e-18 ref|XP_012832303.1| PREDICTED: sialidase [Erythranthe guttatus] ... 97 3e-18 ref|XP_002528710.1| DNA binding protein, putative [Ricinus commu... 96 7e-18 ref|XP_002266425.1| PREDICTED: putative GPI-anchored protein PB1... 96 9e-18 gb|KJB29845.1| hypothetical protein B456_005G121000 [Gossypium r... 96 1e-17 >ref|XP_011095170.1| PREDICTED: proteoglycan 4 [Sesamum indicum] Length = 552 Score = 103 bits (258), Expect = 3e-20 Identities = 50/61 (81%), Positives = 52/61 (85%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSS DGGKHDYDWLLTPPGTPLVPSSDGNESQ +APR P +RSISTTKASRL Sbjct: 74 DDLLSSADGGKHDYDWLLTPPGTPLVPSSDGNESQMGLMAPRSGPLVRSISTTKASRLSV 133 Query: 183 S 185 S Sbjct: 134 S 134 >ref|XP_007033485.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508712514|gb|EOY04411.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 578 Score = 100 bits (249), Expect = 4e-19 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSSTDGGKHDYDWLLTPPGTPL PSS+G+ESQS +APR + +RS+STTK SRL Sbjct: 85 DDLLSSTDGGKHDYDWLLTPPGTPLFPSSEGSESQSTSLAPRSNSKVRSVSTTKTSRLSV 144 Query: 183 S 185 S Sbjct: 145 S 145 >ref|XP_007033484.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] gi|508712513|gb|EOY04410.1| Uncharacterized protein isoform 2, partial [Theobroma cacao] Length = 522 Score = 100 bits (249), Expect = 4e-19 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSSTDGGKHDYDWLLTPPGTPL PSS+G+ESQS +APR + +RS+STTK SRL Sbjct: 29 DDLLSSTDGGKHDYDWLLTPPGTPLFPSSEGSESQSTSLAPRSNSKVRSVSTTKTSRLSV 88 Query: 183 S 185 S Sbjct: 89 S 89 >ref|XP_006481235.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform X1 [Citrus sinensis] gi|568855282|ref|XP_006481236.1| PREDICTED: putative GPI-anchored protein PB15E9.01c-like isoform X2 [Citrus sinensis] Length = 582 Score = 100 bits (248), Expect = 5e-19 Identities = 49/61 (80%), Positives = 52/61 (85%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSSTDGGKHDYDWLLTPPGTPL PSSDG+ESQ PVAPR S RS+ST+KASRL Sbjct: 89 DDLLSSTDGGKHDYDWLLTPPGTPLFPSSDGSESQLNPVAPRISSLARSVSTSKASRLSV 148 Query: 183 S 185 S Sbjct: 149 S 149 >ref|XP_010036018.1| PREDICTED: sialidase isoform X1 [Eucalyptus grandis] Length = 586 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/61 (77%), Positives = 50/61 (81%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLL+STDGGKHDYDWLLTPPGTPL PSSDGNESQS PR S ++RS STTK SRL Sbjct: 90 DDLLTSTDGGKHDYDWLLTPPGTPLFPSSDGNESQSNTAVPRSSSNVRSTSTTKVSRLSV 149 Query: 183 S 185 S Sbjct: 150 S 150 >gb|KCW47541.1| hypothetical protein EUGRSUZ_K01295 [Eucalyptus grandis] Length = 596 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/61 (77%), Positives = 50/61 (81%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLL+STDGGKHDYDWLLTPPGTPL PSSDGNESQS PR S ++RS STTK SRL Sbjct: 90 DDLLTSTDGGKHDYDWLLTPPGTPLFPSSDGNESQSNTAVPRSSSNVRSTSTTKVSRLSV 149 Query: 183 S 185 S Sbjct: 150 S 150 >gb|KCW47540.1| hypothetical protein EUGRSUZ_K01295 [Eucalyptus grandis] Length = 595 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/61 (77%), Positives = 50/61 (81%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLL+STDGGKHDYDWLLTPPGTPL PSSDGNESQS PR S ++RS STTK SRL Sbjct: 89 DDLLTSTDGGKHDYDWLLTPPGTPLFPSSDGNESQSNTAVPRSSSNVRSTSTTKVSRLSV 148 Query: 183 S 185 S Sbjct: 149 S 149 >ref|XP_010036019.1| PREDICTED: uncharacterized threonine-rich GPI-anchored glycoprotein PJ4664.02 isoform X2 [Eucalyptus grandis] gi|629081094|gb|KCW47539.1| hypothetical protein EUGRSUZ_K01295 [Eucalyptus grandis] Length = 585 Score = 99.8 bits (247), Expect = 6e-19 Identities = 47/61 (77%), Positives = 50/61 (81%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLL+STDGGKHDYDWLLTPPGTPL PSSDGNESQS PR S ++RS STTK SRL Sbjct: 89 DDLLTSTDGGKHDYDWLLTPPGTPLFPSSDGNESQSNTAVPRSSSNVRSTSTTKVSRLSV 148 Query: 183 S 185 S Sbjct: 149 S 149 >emb|CDP06374.1| unnamed protein product [Coffea canephora] Length = 577 Score = 98.6 bits (244), Expect = 1e-18 Identities = 48/61 (78%), Positives = 52/61 (85%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSSTDGGKHDYDWLLTPPGTPL P+SDGNESQ+VP+A R + RS STTKASRL Sbjct: 84 DDLLSSTDGGKHDYDWLLTPPGTPLFPTSDGNESQTVPMASRTTLLSRSSSTTKASRLSV 143 Query: 183 S 185 S Sbjct: 144 S 144 >gb|KJB27639.1| hypothetical protein B456_005G003100 [Gossypium raimondii] Length = 465 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 2/63 (3%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQS--VPVAPRGSPSIRSISTTKASRL 176 DDLLSSTDGGKHDYDWLLTPPGTP PSS+G+ESQS V VAPR + +RS+STTKASRL Sbjct: 85 DDLLSSTDGGKHDYDWLLTPPGTPFFPSSEGSESQSATVSVAPRSNSKVRSVSTTKASRL 144 Query: 177 LAS 185 S Sbjct: 145 SVS 147 >ref|XP_012481317.1| PREDICTED: sialidase-like [Gossypium raimondii] gi|763760384|gb|KJB27638.1| hypothetical protein B456_005G003100 [Gossypium raimondii] Length = 590 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 2/63 (3%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQS--VPVAPRGSPSIRSISTTKASRL 176 DDLLSSTDGGKHDYDWLLTPPGTP PSS+G+ESQS V VAPR + +RS+STTKASRL Sbjct: 85 DDLLSSTDGGKHDYDWLLTPPGTPFFPSSEGSESQSATVSVAPRSNSKVRSVSTTKASRL 144 Query: 177 LAS 185 S Sbjct: 145 SVS 147 >gb|KJB27637.1| hypothetical protein B456_005G003100 [Gossypium raimondii] Length = 549 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 2/63 (3%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQS--VPVAPRGSPSIRSISTTKASRL 176 DDLLSSTDGGKHDYDWLLTPPGTP PSS+G+ESQS V VAPR + +RS+STTKASRL Sbjct: 85 DDLLSSTDGGKHDYDWLLTPPGTPFFPSSEGSESQSATVSVAPRSNSKVRSVSTTKASRL 144 Query: 177 LAS 185 S Sbjct: 145 SVS 147 >gb|KHG06089.1| Prolactin-3D4 [Gossypium arboreum] Length = 590 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 2/63 (3%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQS--VPVAPRGSPSIRSISTTKASRL 176 DDLLSSTDGGKHDYDWLLTPPGTP PSS+G+ESQS V VAPR + +RS+STTKASRL Sbjct: 85 DDLLSSTDGGKHDYDWLLTPPGTPFFPSSEGSESQSATVSVAPRSNSKVRSVSTTKASRL 144 Query: 177 LAS 185 S Sbjct: 145 SVS 147 >gb|KDO64168.1| hypothetical protein CISIN_1g008000mg [Citrus sinensis] Length = 495 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSS DGGKHDYDWLLTPPGTPL PSSDG+ESQ PVAPR S RS+ST+KASRL Sbjct: 89 DDLLSSIDGGKHDYDWLLTPPGTPLFPSSDGSESQLNPVAPRISSLARSVSTSKASRLSV 148 Query: 183 S 185 S Sbjct: 149 S 149 >gb|KDO64167.1| hypothetical protein CISIN_1g008000mg [Citrus sinensis] Length = 582 Score = 97.8 bits (242), Expect = 2e-18 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSS DGGKHDYDWLLTPPGTPL PSSDG+ESQ PVAPR S RS+ST+KASRL Sbjct: 89 DDLLSSIDGGKHDYDWLLTPPGTPLFPSSDGSESQLNPVAPRISSLARSVSTSKASRLSV 148 Query: 183 S 185 S Sbjct: 149 S 149 >ref|XP_006429634.1| hypothetical protein CICLE_v100114701mg, partial [Citrus clementina] gi|557531691|gb|ESR42874.1| hypothetical protein CICLE_v100114701mg, partial [Citrus clementina] Length = 158 Score = 97.8 bits (242), Expect = 2e-18 Identities = 47/57 (82%), Positives = 50/57 (87%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASR 173 DDLLSSTDGGKHDYDWLLTPPGTPL PSSDG+ESQ PVAPR S RS+ST+KASR Sbjct: 89 DDLLSSTDGGKHDYDWLLTPPGTPLFPSSDGSESQLNPVAPRISSLARSVSTSKASR 145 >ref|XP_012832303.1| PREDICTED: sialidase [Erythranthe guttatus] gi|604343025|gb|EYU42049.1| hypothetical protein MIMGU_mgv1a003860mg [Erythranthe guttata] Length = 559 Score = 97.4 bits (241), Expect = 3e-18 Identities = 47/61 (77%), Positives = 51/61 (83%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSS DGGKHDYDWLLTPPGTPLVPSS+ NESQ+ +APR P +RSIST KASRL Sbjct: 80 DDLLSSADGGKHDYDWLLTPPGTPLVPSSNVNESQTGLMAPRSGPLVRSISTAKASRLSV 139 Query: 183 S 185 S Sbjct: 140 S 140 >ref|XP_002528710.1| DNA binding protein, putative [Ricinus communis] gi|223531882|gb|EEF33699.1| DNA binding protein, putative [Ricinus communis] Length = 580 Score = 96.3 bits (238), Expect = 7e-18 Identities = 46/61 (75%), Positives = 50/61 (81%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSSTDGGKHDYDWLLTPPGTPL P+SDG++SQ VAPR RS+STTKASRL Sbjct: 94 DDLLSSTDGGKHDYDWLLTPPGTPLFPTSDGSDSQPTLVAPRSRSLSRSVSTTKASRLSV 153 Query: 183 S 185 S Sbjct: 154 S 154 >ref|XP_002266425.1| PREDICTED: putative GPI-anchored protein PB15E9.01c [Vitis vinifera] gi|147841364|emb|CAN71240.1| hypothetical protein VITISV_034160 [Vitis vinifera] gi|296085846|emb|CBI31170.3| unnamed protein product [Vitis vinifera] Length = 570 Score = 95.9 bits (237), Expect = 9e-18 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRL 176 DDLLSS +GGKHDYDWLLTPPGTPL PSSDGNESQ +APR S RS STTKASRL Sbjct: 78 DDLLSSVEGGKHDYDWLLTPPGTPLFPSSDGNESQPTMLAPRNSNLARSASTTKASRL 135 >gb|KJB29845.1| hypothetical protein B456_005G121000 [Gossypium raimondii] Length = 445 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/61 (75%), Positives = 52/61 (85%) Frame = +3 Query: 3 DDLLSSTDGGKHDYDWLLTPPGTPLVPSSDGNESQSVPVAPRGSPSIRSISTTKASRLLA 182 DDLLSSTDGGKHDYDWLLTPPGTP+ PSS+G+ESQS APR + +RS+STTKASRL Sbjct: 77 DDLLSSTDGGKHDYDWLLTPPGTPVFPSSEGSESQS---APRSNSKVRSVSTTKASRLSV 133 Query: 183 S 185 S Sbjct: 134 S 134