BLASTX nr result
ID: Forsythia22_contig00041282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00041282 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW59596.1| hypothetical protein EUGRSUZ_H02341 [Eucalyptus g... 57 4e-06 gb|KCW89061.1| hypothetical protein EUGRSUZ_A01387, partial [Euc... 56 8e-06 >gb|KCW59596.1| hypothetical protein EUGRSUZ_H02341 [Eucalyptus grandis] Length = 127 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +1 Query: 34 SLATSQISNETVCFCG*SSITKTSWTKNNLDSRFRGCSFYRQLDACYYFSWLD 192 S S++ +E C+CG + +TSWT+ N RF GCS YR+ C YF W+D Sbjct: 12 SYKKSELDDEYYCYCGLPCLRRTSWTRLNPGRRFHGCSKYREGSKCQYFKWID 64 >gb|KCW89061.1| hypothetical protein EUGRSUZ_A01387, partial [Eucalyptus grandis] Length = 98 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/50 (48%), Positives = 31/50 (62%) Frame = +1 Query: 46 SQISNETVCFCG*SSITKTSWTKNNLDSRFRGCSFYRQLDACYYFSWLDS 195 S+ E +CFCG S KTSWT+ N RF GC+ YR+ C YF W+D+ Sbjct: 16 SEGEGEHLCFCGLPSPRKTSWTRRNPGRRFYGCARYREGSKCKYFEWVDA 65