BLASTX nr result
ID: Forsythia22_contig00040161
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00040161 (749 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 100 9e-19 gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum]... 62 7e-10 gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythr... 65 4e-08 gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partia... 61 8e-07 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 100 bits (249), Expect = 9e-19 Identities = 56/81 (69%), Positives = 60/81 (74%), Gaps = 2/81 (2%) Frame = +1 Query: 22 MKVDYLSIHFKTSIIPSRTKHESFDSFGSHAQLLRVNYHIFFL*ME*AYPLF--FIHIQK 195 MKVDY SI F+ SIIPSRTKHESFDSFGSHAQLL+VN HIFF E P+F QK Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHIFF--YECNEPIFSSLFIFQK 58 Query: 196 KT*SNAKPKYSEDSSDKIKNM 258 +N PKYSEDSSDKIKNM Sbjct: 59 DIETNVIPKYSEDSSDKIKNM 79 >gb|AAA84681.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224350|prf||1102209D ORF 4 Length = 64 Score = 62.0 bits (149), Expect(2) = 7e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 323 ISKNHFLDLK*RKKRNNFADNYIFLILSEESSEYFGFAL 207 +SK FLDLK +KKRNNFADNYIF ILSEESSEYFG L Sbjct: 8 LSKKSFLDLK-KKKRNNFADNYIFFILSEESSEYFGITL 45 Score = 29.3 bits (64), Expect(2) = 7e-10 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 195 FLNMNKEERIGSFHS 151 F NMNKEE+IGS HS Sbjct: 50 FWNMNKEEKIGSLHS 64 >gb|EYU35473.1| hypothetical protein MIMGU_mgv11b021317mg [Erythranthe guttata] Length = 70 Score = 65.1 bits (157), Expect = 4e-08 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = +1 Query: 22 MKVDYLSIHFKTSIIPSRTKHESFDSFGSHAQLLRVNYHIFFL 150 MKVDYL +HFK SIIPSRTKHES DSFGSH QLLR + + Sbjct: 1 MKVDYLFVHFKASIIPSRTKHESKDSFGSHVQLLRCKSRVLII 43 >gb|EYU41120.1| hypothetical protein MIMGU_mgv11b021666mg, partial [Erythranthe guttata] Length = 71 Score = 60.8 bits (146), Expect = 8e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +1 Query: 37 LSIHFKTSIIPSRTKHESFDSFGSHAQLLR 126 LS+HFKTSIIPSRTKHESFD FGSHAQLLR Sbjct: 13 LSVHFKTSIIPSRTKHESFDLFGSHAQLLR 42