BLASTX nr result
ID: Forsythia22_contig00040117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00040117 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008964066.1| RNA polymerase subunit alpha [Ajuga reptans]... 49 3e-06 >ref|YP_008964066.1| RNA polymerase subunit alpha [Ajuga reptans] gi|558697182|gb|AHA84937.1| RNA polymerase subunit alpha [Ajuga reptans] Length = 337 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 28/50 (56%), Positives = 31/50 (62%), Gaps = 5/50 (10%) Frame = -2 Query: 168 NTGSLSPITFHDKLDELGKKKKH*--NRFFY*---LSPSVYNCLKRSNIY 34 +T LSP TFHDK D++ K KK F LSP VYNCLKRSNIY Sbjct: 244 HTAPLSPFTFHDKFDKVRKNKKKIALQSIFIDQSELSPKVYNCLKRSNIY 293 Score = 28.5 bits (62), Expect(2) = 3e-06 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -1 Query: 205 YKEGEILPLEDNQH 164 YKE E LPLEDNQH Sbjct: 231 YKEEENLPLEDNQH 244