BLASTX nr result
ID: Forsythia22_contig00040116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00040116 (897 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621... 41 6e-06 >ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis] Length = 2303 Score = 40.8 bits (94), Expect(2) = 6e-06 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +3 Query: 126 GTELFRWGLRWRIGDGSRVAVFSSPCVQRPHSFLPVTP 239 G ++ + G RWRIG+GS + V+ + RP +F P++P Sbjct: 891 GRQVIQKGARWRIGNGSNILVYKDNWIPRPDTFKPISP 928 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = +2 Query: 257 TSVAELVREDESWNIDILHNRLLPIDKDLILSLPIGVISP-----WHYEQHG 397 T+V EL+ ++ +WN+ L+ + D + IL +P+ WHY++HG Sbjct: 935 TTVGELMDDENNWNVAKLNQHFMQEDTEAILKIPLPRSQKVDEMMWHYDKHG 986