BLASTX nr result
ID: Forsythia22_contig00040086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00040086 (370 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO64128.1| hypothetical protein CISIN_1g045842mg [Citrus sin... 57 6e-06 >gb|KDO64128.1| hypothetical protein CISIN_1g045842mg [Citrus sinensis] Length = 765 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 3/78 (3%) Frame = -2 Query: 363 LAFPLQFSSS---LDCLVFMNPRSTTTSTVSFKAGNKNKFRFWILPCLFPVSFRTPVGIV 193 ++ PL+ S S LD ++FMN + S VS +GNKN F WIL CL P TP+ V Sbjct: 682 VSLPLRPSLSQPRLDSVIFMNLKDIGASAVSCYSGNKNHFFSWILFCLLPKFLGTPIAYV 741 Query: 192 NFLLFKAIACCPSSSVLI 139 F L K + PSS+ ++ Sbjct: 742 PFFLIKVVDRSPSSAFVL 759