BLASTX nr result
ID: Forsythia22_contig00039942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00039942 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090809.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 >ref|XP_011090809.1| PREDICTED: pentatricopeptide repeat-containing protein At5g19020, mitochondrial [Sesamum indicum] Length = 693 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -1 Query: 125 ENIPKKSNNIEFSLVSVLKFISSYPSLISNGQQLHCFIQKS 3 +N PKK N++EFSLVS LK ISS PSL+S+GQQLHC I KS Sbjct: 39 KNTPKKPNSLEFSLVSALKSISSSPSLVSHGQQLHCLILKS 79