BLASTX nr result
ID: Forsythia22_contig00039363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00039363 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN59866.1| hypothetical protein VITISV_013438 [Vitis vinifera] 57 5e-06 >emb|CAN59866.1| hypothetical protein VITISV_013438 [Vitis vinifera] Length = 1040 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/53 (50%), Positives = 33/53 (62%) Frame = -1 Query: 318 ELPSGRTIGSAKVHDGLYYFEDDRPQSRQIFXXXXXXXXXXSTREIMLWQHRL 160 +L SGRTIGSA++H+GLYY + + RQ F S REIMLW HRL Sbjct: 349 DLSSGRTIGSARIHEGLYYLNNTEYEGRQAFVSGVASVSISSAREIMLWHHRL 401