BLASTX nr result
ID: Forsythia22_contig00038300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00038300 (247 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KKY37929.1| putative 40s ribosomal protein s25 [Diaporthe amp... 65 1e-08 ref|XP_007918244.1| putative 40s ribosomal protein s25 protein [... 64 3e-08 ref|XP_007799003.1| putative 40s ribosomal protein s25 protein [... 63 7e-08 ref|XP_003709364.1| 40S ribosomal protein S25 [Magnaporthe oryza... 62 2e-07 ref|XP_007835575.1| 40S ribosomal protein S25 [Pestalotiopsis fi... 61 3e-07 gb|KLU91585.1| 40S ribosomal protein S25 [Magnaporthiopsis poae ... 59 2e-06 ref|XP_009227206.1| 40S ribosomal protein S25 [Gaeumannomyces gr... 59 2e-06 gb|KEY64494.1| hypothetical protein S7711_07242 [Stachybotrys ch... 58 2e-06 ref|XP_001228474.1| 40S ribosomal protein S25 [Chaetomium globos... 58 2e-06 ref|XP_003667289.1| hypothetical protein MYCTH_71631 [Myceliopht... 58 2e-06 ref|XP_003658187.1| 40S ribosomal protein S25 [Thielavia terrest... 58 2e-06 gb|KEZ46058.1| hypothetical protein SAPIO_CDS0903 [Scedosporium ... 58 3e-06 ref|XP_003051616.1| 40S ribosomal protein S25 [Nectria haematoco... 58 3e-06 ref|XP_963231.1| 40S ribosomal protein S25 [Neurospora crassa OR... 57 4e-06 emb|CCT67556.1| probable ribosomal protein S25.e.c7 [Fusarium fu... 57 5e-06 gb|KJK82252.1| hypothetical protein H634G_02446 [Metarhizium ani... 57 6e-06 gb|KID88918.1| Ribosomal protein S25 [Metarhizium guizhouense AR... 57 6e-06 gb|KID76756.1| Ribosomal protein S25, partial [Metarhizium brunn... 57 6e-06 ref|XP_007818732.2| Ribosomal protein S25 [Metarhizium robertsii... 57 6e-06 gb|KFG79372.1| 40S ribosomal protein S25 [Metarhizium anisopliae... 57 6e-06 >gb|KKY37929.1| putative 40s ribosomal protein s25 [Diaporthe ampelina] Length = 97 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE Sbjct: 67 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 97 >ref|XP_007918244.1| putative 40s ribosomal protein s25 protein [Togninia minima UCRPA7] gi|500253249|gb|EON96978.1| putative 40s ribosomal protein s25 protein [Togninia minima UCRPA7] Length = 97 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS+ Sbjct: 67 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASD 97 >ref|XP_007799003.1| putative 40s ribosomal protein s25 protein [Eutypa lata UCREL1] gi|471559567|gb|EMR61910.1| putative 40s ribosomal protein s25 protein [Eutypa lata UCREL1] Length = 106 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQI+PIVTHSKMKIYTRAVGAS+ Sbjct: 76 CLKDLEEKGQIRPIVTHSKMKIYTRAVGASD 106 >ref|XP_003709364.1| 40S ribosomal protein S25 [Magnaporthe oryzae 70-15] gi|351648893|gb|EHA56752.1| 40S ribosomal protein S25 [Magnaporthe oryzae 70-15] Length = 94 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CL DLEEKGQIKP+VTHSKMKIYTRAVGA+E Sbjct: 64 CLADLEEKGQIKPVVTHSKMKIYTRAVGAAE 94 >ref|XP_007835575.1| 40S ribosomal protein S25 [Pestalotiopsis fici W106-1] gi|573059152|gb|ETS78950.1| 40S ribosomal protein S25 [Pestalotiopsis fici W106-1] Length = 97 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIK +VTHSKMKIYTRAVGAS+ Sbjct: 67 CLKDLEEKGQIKSVVTHSKMKIYTRAVGASD 97 >gb|KLU91585.1| 40S ribosomal protein S25 [Magnaporthiopsis poae ATCC 64411] Length = 96 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CL DLEEKGQIKP+VTHSKMKIYTRAV A+E Sbjct: 66 CLADLEEKGQIKPVVTHSKMKIYTRAVTAAE 96 >ref|XP_009227206.1| 40S ribosomal protein S25 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402076386|gb|EJT71809.1| 40S ribosomal protein S25 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 96 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CL DLEEKGQIKP+VTHSKMKIYTRAV A+E Sbjct: 66 CLADLEEKGQIKPVVTHSKMKIYTRAVTAAE 96 >gb|KEY64494.1| hypothetical protein S7711_07242 [Stachybotrys chartarum IBT 7711] gi|667520306|gb|KFA49621.1| hypothetical protein S40293_06612 [Stachybotrys chartarum IBT 40293] gi|667721544|gb|KFA63789.1| hypothetical protein S40285_01963 [Stachybotrys chlorohalonata IBT 40285] gi|667743509|gb|KFA81860.1| hypothetical protein S40288_01733 [Stachybotrys chartarum IBT 40288] Length = 95 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS 156 C+KDLEEKG IKP+VTHSKMKIYTRAVG+S Sbjct: 66 CIKDLEEKGIIKPVVTHSKMKIYTRAVGSS 95 >ref|XP_001228474.1| 40S ribosomal protein S25 [Chaetomium globosum CBS 148.51] gi|88176675|gb|EAQ84143.1| 40S ribosomal protein S25 [Chaetomium globosum CBS 148.51] Length = 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIK +V HSKMKIYTRAVGA+E Sbjct: 67 CLKDLEEKGQIKQVVGHSKMKIYTRAVGAAE 97 >ref|XP_003667289.1| hypothetical protein MYCTH_71631 [Myceliophthora thermophila ATCC 42464] gi|347014562|gb|AEO62044.1| hypothetical protein MYCTH_71631 [Myceliophthora thermophila ATCC 42464] Length = 98 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIK +V HSKMKIYTRAVGA+E Sbjct: 68 CLKDLEEKGQIKQVVGHSKMKIYTRAVGAAE 98 >ref|XP_003658187.1| 40S ribosomal protein S25 [Thielavia terrestris NRRL 8126] gi|347005453|gb|AEO71851.1| hypothetical protein THITE_2071900 [Thielavia terrestris NRRL 8126] Length = 97 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIK +V HSKMKIYTRAVGA+E Sbjct: 67 CLKDLEEKGQIKQVVGHSKMKIYTRAVGAAE 97 >gb|KEZ46058.1| hypothetical protein SAPIO_CDS0903 [Scedosporium apiospermum] Length = 96 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CL+DLEEKG IKP+V HSKMKIYTRAVGAS+ Sbjct: 66 CLRDLEEKGLIKPVVEHSKMKIYTRAVGASD 96 >ref|XP_003051616.1| 40S ribosomal protein S25 [Nectria haematococca mpVI 77-13-4] gi|256732555|gb|EEU45903.1| hypothetical protein NECHADRAFT_102538 [Nectria haematococca mpVI 77-13-4] Length = 96 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CL DLEEKG IKP++THSKMKIYTRAVG S+ Sbjct: 66 CLADLEEKGMIKPVITHSKMKIYTRAVGGSD 96 >ref|XP_963231.1| 40S ribosomal protein S25 [Neurospora crassa OR74A] gi|698989420|ref|XP_009851691.1| hypothetical protein NEUTE1DRAFT_95095 [Neurospora tetrasperma FGSC 2508] gi|51701991|sp|Q7SC06.1|RS25_NEUCR RecName: Full=40S ribosomal protein S25 gi|28924901|gb|EAA33995.1| 40S ribosomal protein S25 [Neurospora crassa OR74A] gi|38524277|emb|CAE75741.1| probable ribosomal protein S25.e.c7 [Neurospora crassa] gi|336467884|gb|EGO56047.1| hypothetical protein NEUTE1DRAFT_95095 [Neurospora tetrasperma FGSC 2508] gi|350289879|gb|EGZ71104.1| ribosomal protein S25 [Neurospora tetrasperma FGSC 2509] gi|725980156|gb|KHE83351.1| hypothetical protein GE21DRAFT_3746 [Neurospora crassa] Length = 97 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CLKDLEEKGQIK +V HSKMKIYTRA+GA E Sbjct: 67 CLKDLEEKGQIKQVVGHSKMKIYTRAIGADE 97 >emb|CCT67556.1| probable ribosomal protein S25.e.c7 [Fusarium fujikuroi IMI 58289] gi|584133613|gb|EWG42986.1| 40S ribosomal protein S25 [Fusarium verticillioides 7600] gi|587680053|gb|EWZ02371.1| S25 ribosomal protein [Fusarium oxysporum FOSC 3-a] gi|587701851|gb|EWZ48456.1| S25 ribosomal protein [Fusarium oxysporum Fo47] gi|587722186|gb|EWZ93523.1| S25 ribosomal protein [Fusarium oxysporum f. sp. lycopersici MN25] gi|587744271|gb|EXA41987.1| S25 ribosomal protein [Fusarium oxysporum f. sp. pisi HDV247] gi|590043939|gb|EXK45797.1| S25 ribosomal protein [Fusarium oxysporum f. sp. melonis 26406] gi|590069442|gb|EXK96966.1| S25 ribosomal protein [Fusarium oxysporum f. sp. raphani 54005] gi|591418649|gb|EXL53786.1| S25 ribosomal protein [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591446965|gb|EXL79423.1| S25 ribosomal protein [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591475865|gb|EXM07037.1| S25 ribosomal protein [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591504643|gb|EXM33966.1| S25 ribosomal protein [Fusarium oxysporum f. sp. vasinfectum 25433] gi|829114743|gb|KLO91129.1| putative ribosomal protein S25.e.c7 [Fusarium fujikuroi] gi|829126594|gb|KLP01738.1| putative ribosomal protein S25.e.c7 [Fusarium fujikuroi] gi|829153606|gb|KLP20892.1| putative ribosomal protein S25.e.c7 [Fusarium fujikuroi] Length = 96 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGASE 153 CL DLEEKG IKP+VTHSKMKIYTRAVG S+ Sbjct: 66 CLADLEEKGIIKPVVTHSKMKIYTRAVGGSD 96 >gb|KJK82252.1| hypothetical protein H634G_02446 [Metarhizium anisopliae BRIP 53293] gi|770407871|gb|KJK92712.1| hypothetical protein H633G_03425 [Metarhizium anisopliae BRIP 53284] Length = 121 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS 156 CL DLEEKG IKP+VTHSKMKIYTRAVG S Sbjct: 92 CLADLEEKGLIKPVVTHSKMKIYTRAVGGS 121 >gb|KID88918.1| Ribosomal protein S25 [Metarhizium guizhouense ARSEF 977] gi|743675749|gb|KIE02665.1| Ribosomal protein S25, partial [Metarhizium majus ARSEF 297] Length = 103 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS 156 CL DLEEKG IKP+VTHSKMKIYTRAVG S Sbjct: 74 CLADLEEKGLIKPVVTHSKMKIYTRAVGGS 103 >gb|KID76756.1| Ribosomal protein S25, partial [Metarhizium brunneum ARSEF 3297] Length = 121 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS 156 CL DLEEKG IKP+VTHSKMKIYTRAVG S Sbjct: 92 CLADLEEKGLIKPVVTHSKMKIYTRAVGGS 121 >ref|XP_007818732.2| Ribosomal protein S25 [Metarhizium robertsii ARSEF 23] gi|734840202|gb|EFZ01314.2| Ribosomal protein S25 [Metarhizium robertsii ARSEF 23] Length = 94 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS 156 CL DLEEKG IKP+VTHSKMKIYTRAVG S Sbjct: 65 CLADLEEKGLIKPVVTHSKMKIYTRAVGGS 94 >gb|KFG79372.1| 40S ribosomal protein S25 [Metarhizium anisopliae] gi|743640552|gb|KID71919.1| Ribosomal protein S25, partial [Metarhizium anisopliae ARSEF 549] Length = 121 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -3 Query: 245 CLKDLEEKGQIKPIVTHSKMKIYTRAVGAS 156 CL DLEEKG IKP+VTHSKMKIYTRAVG S Sbjct: 92 CLADLEEKGLIKPVVTHSKMKIYTRAVGGS 121