BLASTX nr result
ID: Forsythia22_contig00037383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00037383 (349 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097887.1| PREDICTED: uncharacterized protein LOC105176... 57 6e-06 >ref|XP_011097887.1| PREDICTED: uncharacterized protein LOC105176694 [Sesamum indicum] Length = 694 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 219 PAKDLLHNPHSVFGPRNGNRLSFKFKRSFQFLNFAMEGATKWD 347 PAKD +HNPHSV P++G L +KF+ SF N AMEGATKWD Sbjct: 150 PAKDPIHNPHSVSDPKHG--LFYKFEPSFHLPNSAMEGATKWD 190