BLASTX nr result
ID: Forsythia22_contig00037321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00037321 (664 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like ... 60 1e-06 ref|XP_012091044.1| PREDICTED: vacuolar-sorting receptor 1-like ... 59 2e-06 ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like ... 57 7e-06 ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like ... 57 7e-06 >ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica] Length = 625 Score = 60.1 bits (144), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -3 Query: 104 MREHIVFLVCVWFLLSGSCFGKFVVEKNSLKVTS 3 MRE + FLVCVWFLL G CFG+FVVEKNSLK+TS Sbjct: 1 MREKLGFLVCVWFLLCGFCFGRFVVEKNSLKLTS 34 >ref|XP_012091044.1| PREDICTED: vacuolar-sorting receptor 1-like [Jatropha curcas] gi|643705246|gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas] Length = 622 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 104 MREHIVFLVCVWFLLSGSCFGKFVVEKNSLKVTS 3 MRE + FLV VWFLL GSCFG+FVVEKNSLKVTS Sbjct: 1 MREKLGFLVFVWFLLCGSCFGRFVVEKNSLKVTS 34 >ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum lycopersicum] Length = 624 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 104 MREHIVFLVCVWFLLSGSCFGKFVVEKNSLKVTS 3 M+E + FLVCVWFL+ GSC G+FVVEKNSL+VTS Sbjct: 1 MKEKLGFLVCVWFLVIGSCLGRFVVEKNSLRVTS 34 >ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum lycopersicum] Length = 626 Score = 57.4 bits (137), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 104 MREHIVFLVCVWFLLSGSCFGKFVVEKNSLKVTS 3 M+E + FLVCVWFL+ GSC G+FVVEKNSL+VTS Sbjct: 1 MKEKLGFLVCVWFLVIGSCLGRFVVEKNSLRVTS 34