BLASTX nr result
ID: Forsythia22_contig00037012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00037012 (322 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086783.1| PREDICTED: CTD small phosphatase-like protei... 57 5e-06 ref|XP_011086782.1| PREDICTED: CTD small phosphatase-like protei... 57 5e-06 >ref|XP_011086783.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X2 [Sesamum indicum] Length = 427 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -1 Query: 322 PRVSRQQKKLSENVQVQPKKVAELITSYARKKKV 221 PRVSRQQKKL ENVQVQ KKV ELITS ARKKKV Sbjct: 18 PRVSRQQKKLVENVQVQGKKVTELITSSARKKKV 51 >ref|XP_011086782.1| PREDICTED: CTD small phosphatase-like protein 2 isoform X1 [Sesamum indicum] Length = 428 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/34 (88%), Positives = 30/34 (88%) Frame = -1 Query: 322 PRVSRQQKKLSENVQVQPKKVAELITSYARKKKV 221 PRVSRQQKKL ENVQVQ KKV ELITS ARKKKV Sbjct: 18 PRVSRQQKKLVENVQVQGKKVTELITSSARKKKV 51