BLASTX nr result
ID: Forsythia22_contig00036791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00036791 (230 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030144.1| Leucine-rich repeat containing protein isofo... 57 4e-06 >ref|XP_007030144.1| Leucine-rich repeat containing protein isoform 1 [Theobroma cacao] gi|508718749|gb|EOY10646.1| Leucine-rich repeat containing protein isoform 1 [Theobroma cacao] Length = 855 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 4/78 (5%) Frame = -3 Query: 228 VIEREALKWINLSEYHGLDEQTEKIENLMCETE---GNI-AIGIVGMSGSGKSALARKVF 61 VI RE ++N S+ G DE EKI NL+ E GNI I IVG+ G GK+ LA+ V+ Sbjct: 151 VIHRETYSFVNSSDVIGRDEDREKIINLLKEPSDESGNIPVIPIVGIGGLGKTTLAQFVY 210 Query: 60 FSSRVEQLFELMLWVDLS 7 RV +LF L +WV +S Sbjct: 211 NDERVIKLFSLRIWVCVS 228