BLASTX nr result
ID: Forsythia22_contig00036754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00036754 (489 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009350089.1| PREDICTED: histone H2B.9-like [Pyrus x brets... 79 1e-12 ref|XP_009377099.1| PREDICTED: histone H2B.9-like [Pyrus x brets... 79 1e-12 ref|XP_009374658.1| PREDICTED: histone H2B.9-like [Pyrus x brets... 79 1e-12 ref|XP_008363846.1| PREDICTED: histone H2B.9-like [Malus domestica] 79 1e-12 ref|XP_008387734.1| PREDICTED: histone H2B.9-like [Malus domesti... 79 1e-12 ref|XP_008241461.1| PREDICTED: probable histone H2B.3 [Prunus mume] 79 1e-12 ref|XP_004302789.1| PREDICTED: histone H2B.9 [Fragaria vesca sub... 79 1e-12 ref|XP_007207826.1| hypothetical protein PRUPE_ppa023550mg [Prun... 79 1e-12 ref|XP_010112903.1| putative histone H2B.1 [Morus notabilis] gi|... 75 1e-11 ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141... 75 1e-11 ref|XP_010097583.1| putative histone H2B.1 [Morus notabilis] gi|... 75 1e-11 ref|XP_010092780.1| putative histone H2B.1 [Morus notabilis] gi|... 75 1e-11 ref|NP_187559.1| histone H2B [Arabidopsis thaliana] gi|75204313... 75 1e-11 ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii]... 75 1e-11 ref|XP_012572749.1| PREDICTED: probable histone H2B.1 [Cicer ari... 75 1e-11 ref|XP_012570040.1| PREDICTED: histone H2B.3-like [Cicer arietinum] 75 1e-11 ref|XP_012569399.1| PREDICTED: probable histone H2B.3 [Cicer ari... 75 1e-11 ref|XP_012569398.1| PREDICTED: probable histone H2B.3 [Cicer ari... 75 1e-11 ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimo... 75 1e-11 ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium... 75 1e-11 >ref|XP_009350089.1| PREDICTED: histone H2B.9-like [Pyrus x bretschneideri] Length = 139 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 93 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 139 >ref|XP_009377099.1| PREDICTED: histone H2B.9-like [Pyrus x bretschneideri] Length = 137 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 91 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 137 >ref|XP_009374658.1| PREDICTED: histone H2B.9-like [Pyrus x bretschneideri] Length = 139 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 93 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 139 >ref|XP_008363846.1| PREDICTED: histone H2B.9-like [Malus domestica] Length = 137 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 91 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 137 >ref|XP_008387734.1| PREDICTED: histone H2B.9-like [Malus domestica] gi|658029949|ref|XP_008350423.1| PREDICTED: histone H2B.9-like [Malus domestica] Length = 139 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 93 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 139 >ref|XP_008241461.1| PREDICTED: probable histone H2B.3 [Prunus mume] Length = 134 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 88 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 134 >ref|XP_004302789.1| PREDICTED: histone H2B.9 [Fragaria vesca subsp. vesca] Length = 130 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 84 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 130 >ref|XP_007207826.1| hypothetical protein PRUPE_ppa023550mg [Prunus persica] gi|462403468|gb|EMJ09025.1| hypothetical protein PRUPE_ppa023550mg [Prunus persica] Length = 134 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTSC 347 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTSC Sbjct: 88 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC 134 >ref|XP_010112903.1| putative histone H2B.1 [Morus notabilis] gi|587948819|gb|EXC35052.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 102 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 147 >ref|XP_010109932.1| Histone H2B.3 [Morus notabilis] gi|587938141|gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 100 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 145 >ref|XP_010097583.1| putative histone H2B.1 [Morus notabilis] gi|703126936|ref|XP_010103707.1| putative histone H2B.1 [Morus notabilis] gi|703157924|ref|XP_010111853.1| putative histone H2B.1 [Morus notabilis] gi|587880158|gb|EXB69115.1| putative histone H2B.1 [Morus notabilis] gi|587908853|gb|EXB96786.1| putative histone H2B.1 [Morus notabilis] gi|587945411|gb|EXC31818.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 102 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 147 >ref|XP_010092780.1| putative histone H2B.1 [Morus notabilis] gi|587862441|gb|EXB52245.1| putative histone H2B.1 [Morus notabilis] Length = 148 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 102 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 147 >ref|NP_187559.1| histone H2B [Arabidopsis thaliana] gi|75204313|sp|Q9SF55.3|H2B5_ARATH RecName: Full=Histone H2B.5; AltName: Full=HTB7 gi|6682228|gb|AAF23280.1|AC016661_5 putative histone H2B [Arabidopsis thaliana] gi|34365619|gb|AAQ65121.1| At3g09480 [Arabidopsis thaliana] gi|51969742|dbj|BAD43563.1| putative histone H2B [Arabidopsis thaliana] gi|51970148|dbj|BAD43766.1| putative histone H2B [Arabidopsis thaliana] gi|51971867|dbj|BAD44598.1| putative histone H2B [Arabidopsis thaliana] gi|332641251|gb|AEE74772.1| histone H2B [Arabidopsis thaliana] Length = 126 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 80 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 125 >ref|XP_012471398.1| PREDICTED: histone H2B [Gossypium raimondii] gi|7387726|sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B [Gossypium hirsutum] gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] gi|763752774|gb|KJB20162.1| hypothetical protein B456_003G136000 [Gossypium raimondii] Length = 147 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 101 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 146 >ref|XP_012572749.1| PREDICTED: probable histone H2B.1 [Cicer arietinum] gi|828320856|ref|XP_012572750.1| PREDICTED: probable histone H2B.1 [Cicer arietinum] Length = 149 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 103 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 148 >ref|XP_012570040.1| PREDICTED: histone H2B.3-like [Cicer arietinum] Length = 126 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 80 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 125 >ref|XP_012569399.1| PREDICTED: probable histone H2B.3 [Cicer arietinum] Length = 139 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 93 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 138 >ref|XP_012569398.1| PREDICTED: probable histone H2B.3 [Cicer arietinum] Length = 139 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 93 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 138 >ref|XP_012461908.1| PREDICTED: histone H2B-like [Gossypium raimondii] Length = 288 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 101 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 146 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 242 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 287 >ref|XP_012468377.1| PREDICTED: probable histone H2B.3 [Gossypium raimondii] Length = 138 Score = 75.5 bits (184), Expect = 1e-11 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -3 Query: 487 SRLVTYNKKPKITSRKIQTAVQLVLSRELAKHAVSEGTKAVTKFTS 350 SRL YNKKP ITSR+IQTAV+LVL ELAKHAVSEGTKAVTKFTS Sbjct: 92 SRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 137