BLASTX nr result
ID: Forsythia22_contig00036585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00036585 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078840.1| PREDICTED: UBP1-associated protein 2C-like i... 60 7e-07 ref|XP_012857269.1| PREDICTED: UBP1-associated protein 2C-like [... 59 2e-06 gb|EYU20704.1| hypothetical protein MIMGU_mgv1a0010912mg, partia... 59 2e-06 >ref|XP_011078840.1| PREDICTED: UBP1-associated protein 2C-like isoform X1 [Sesamum indicum] Length = 336 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -1 Query: 117 NDQLLPNLNETAPSTTMEELRSLLDPLAKPQLVDLLSK 4 N QLLPNLNE+ S+T+EELR LLDPL+KPQLVDLL++ Sbjct: 14 NGQLLPNLNESEASSTVEELRGLLDPLSKPQLVDLLAR 51 >ref|XP_012857269.1| PREDICTED: UBP1-associated protein 2C-like [Erythranthe guttatus] Length = 334 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -1 Query: 117 NDQLLPNLNETAPSTTMEELRSLLDPLAKPQLVDLLSK 4 N + LPNLN+TAPS+T+EELR+LLDPLAKP LV+LL++ Sbjct: 14 NGRSLPNLNDTAPSSTLEELRTLLDPLAKPLLVNLLAR 51 >gb|EYU20704.1| hypothetical protein MIMGU_mgv1a0010912mg, partial [Erythranthe guttata] Length = 308 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -1 Query: 117 NDQLLPNLNETAPSTTMEELRSLLDPLAKPQLVDLLSK 4 N + LPNLN+TAPS+T+EELR+LLDPLAKP LV+LL++ Sbjct: 14 NGRSLPNLNDTAPSSTLEELRTLLDPLAKPLLVNLLAR 51