BLASTX nr result
ID: Forsythia22_contig00034451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034451 (259 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB36810.1| spliceosome associated protein-like [Arabidopsis... 55 9e-11 >emb|CAB36810.1| spliceosome associated protein-like [Arabidopsis thaliana] gi|7268963|emb|CAB81273.1| spliceosome associated protein-like [Arabidopsis thaliana] Length = 700 Score = 55.5 bits (132), Expect(2) = 9e-11 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 259 KRGIEKQPFQLPDFIAATGIEKIRQVR*IL 170 KRGIEKQPF LPDFIAATGIEKIRQV+ IL Sbjct: 284 KRGIEKQPFHLPDFIAATGIEKIRQVKVIL 313 Score = 37.4 bits (85), Expect(2) = 9e-11 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 54 AYIEKEDSKKLKQKQRER 1 AYIEKED KKLKQKQRER Sbjct: 318 AYIEKEDGKKLKQKQRER 335