BLASTX nr result
ID: Forsythia22_contig00034308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034308 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007012781.1| Membrane bound O-acyl transferase family pro... 64 4e-08 >ref|XP_007012781.1| Membrane bound O-acyl transferase family protein isoform 4 [Theobroma cacao] gi|508783144|gb|EOY30400.1| Membrane bound O-acyl transferase family protein isoform 4 [Theobroma cacao] Length = 382 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 265 KLSVPNLYVWLCMFYCFFHLWYVLSFLSY*KSFFPL 158 KLSVPNLYVWLCMFYCFFHLWY+ S+ + FF L Sbjct: 338 KLSVPNLYVWLCMFYCFFHLWYICSYYFWTIQFFSL 373