BLASTX nr result
ID: Forsythia22_contig00034153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034153 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077979.1| PREDICTED: WD-40 repeat-containing protein M... 65 2e-08 ref|XP_012848155.1| PREDICTED: WD-40 repeat-containing protein M... 64 5e-08 gb|EYU28408.1| hypothetical protein MIMGU_mgv1a005342mg [Erythra... 64 5e-08 emb|CDP03161.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_004287561.1| PREDICTED: WD-40 repeat-containing protein M... 59 1e-06 ref|XP_010925450.1| PREDICTED: WD-40 repeat-containing protein M... 59 2e-06 ref|XP_006826731.1| PREDICTED: WD-40 repeat-containing protein M... 58 2e-06 gb|EPS70167.1| nucleosome/chromatin assembly factor group, parti... 58 2e-06 ref|XP_010049750.1| PREDICTED: WD-40 repeat-containing protein M... 58 3e-06 gb|KCW82508.1| hypothetical protein EUGRSUZ_C039012, partial [Eu... 58 3e-06 ref|XP_008793221.1| PREDICTED: WD-40 repeat-containing protein M... 57 4e-06 ref|XP_008793220.1| PREDICTED: WD-40 repeat-containing protein M... 57 4e-06 gb|AFD61545.1| WD-40 repeat protein MSI4 [Dendrobium nobile] 57 5e-06 gb|AEF01212.1| FVE [x Doritaenopsis hybrid cultivar] 57 5e-06 gb|KGN66243.1| hypothetical protein Csa_1G588520 [Cucumis sativus] 57 6e-06 ref|XP_008450857.1| PREDICTED: WD-40 repeat-containing protein M... 57 6e-06 ref|XP_004135716.2| PREDICTED: WD-40 repeat-containing protein M... 57 6e-06 ref|XP_010242216.1| PREDICTED: WD-40 repeat-containing protein M... 56 8e-06 ref|XP_010262125.1| PREDICTED: WD-40 repeat-containing protein M... 56 8e-06 ref|XP_009804576.1| PREDICTED: WD-40 repeat-containing protein M... 56 8e-06 >ref|XP_011077979.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Sesamum indicum] Length = 494 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSKT 185 +WRMTDLLYRP+EEVL ELQKFKDHV+ECSKT Sbjct: 462 LWRMTDLLYRPKEEVLAELQKFKDHVIECSKT 493 >ref|XP_012848155.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Erythranthe guttatus] gi|604315844|gb|EYU28409.1| hypothetical protein MIMGU_mgv1a005342mg [Erythranthe guttata] Length = 488 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSKT 185 +WRMTDLLYRP++EVL ELQKFKDHV+ECSKT Sbjct: 455 LWRMTDLLYRPKDEVLVELQKFKDHVIECSKT 486 >gb|EYU28408.1| hypothetical protein MIMGU_mgv1a005342mg [Erythranthe guttata] Length = 466 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSKT 185 +WRMTDLLYRP++EVL ELQKFKDHV+ECSKT Sbjct: 433 LWRMTDLLYRPKDEVLVELQKFKDHVIECSKT 464 >emb|CDP03161.1| unnamed protein product [Coffea canephora] Length = 495 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRMTDLLYRPE+EVL ELQ FKDHV+EC+ Sbjct: 463 IWRMTDLLYRPEDEVLAELQHFKDHVIECT 492 >ref|XP_004287561.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Fragaria vesca subsp. vesca] Length = 500 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSK 188 IWRM+DL+YRPEEEVLEEL+KFK HV+ C+K Sbjct: 469 IWRMSDLIYRPEEEVLEELEKFKSHVISCAK 499 >ref|XP_010925450.1| PREDICTED: WD-40 repeat-containing protein MSI4-like isoform X1 [Elaeis guineensis] Length = 472 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVL EL+KFKDH+L CS Sbjct: 440 IWRMSDLIYRPEEEVLAELEKFKDHILSCS 469 >ref|XP_006826731.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Amborella trichopoda] gi|548831151|gb|ERM93968.1| hypothetical protein AMTR_s00136p00031470 [Amborella trichopoda] Length = 470 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVLEEL+KFK H+L CS Sbjct: 438 IWRMSDLIYRPEEEVLEELEKFKSHILTCS 467 >gb|EPS70167.1| nucleosome/chromatin assembly factor group, partial [Genlisea aurea] Length = 324 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSKT 185 IWRM DL+YRPE+EV+ EL+KFKDH+L CSKT Sbjct: 293 IWRMMDLIYRPEDEVVGELEKFKDHLLSCSKT 324 >ref|XP_010049750.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Eucalyptus grandis] Length = 518 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSK 188 IWRM+DL+YRPEEEVL EL+ FK HVLECSK Sbjct: 487 IWRMSDLIYRPEEEVLAELENFKAHVLECSK 517 >gb|KCW82508.1| hypothetical protein EUGRSUZ_C039012, partial [Eucalyptus grandis] Length = 347 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECSK 188 IWRM+DL+YRPEEEVL EL+ FK HVLECSK Sbjct: 316 IWRMSDLIYRPEEEVLAELENFKAHVLECSK 346 >ref|XP_008793221.1| PREDICTED: WD-40 repeat-containing protein MSI4-like isoform X2 [Phoenix dactylifera] Length = 450 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVLEEL+KFKD +L CS Sbjct: 418 IWRMSDLIYRPEEEVLEELEKFKDDILSCS 447 >ref|XP_008793220.1| PREDICTED: WD-40 repeat-containing protein MSI4-like isoform X1 [Phoenix dactylifera] Length = 471 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVLEEL+KFKD +L CS Sbjct: 439 IWRMSDLIYRPEEEVLEELEKFKDDILSCS 468 >gb|AFD61545.1| WD-40 repeat protein MSI4 [Dendrobium nobile] Length = 468 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVLEEL+KFK H+L C+ Sbjct: 436 IWRMSDLIYRPEEEVLEELEKFKSHILTCA 465 >gb|AEF01212.1| FVE [x Doritaenopsis hybrid cultivar] Length = 468 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVLEEL+KFK H+L C+ Sbjct: 436 IWRMSDLIYRPEEEVLEELEKFKSHILTCA 465 >gb|KGN66243.1| hypothetical protein Csa_1G588520 [Cucumis sativus] Length = 534 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVL EL+KFK HV+EC+ Sbjct: 502 IWRMSDLIYRPEEEVLAELEKFKSHVIECA 531 >ref|XP_008450857.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Cucumis melo] Length = 518 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVL EL+KFK HV+EC+ Sbjct: 486 IWRMSDLIYRPEEEVLAELEKFKSHVIECA 515 >ref|XP_004135716.2| PREDICTED: WD-40 repeat-containing protein MSI4 [Cucumis sativus] Length = 518 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVL EL+KFK HV+EC+ Sbjct: 486 IWRMSDLIYRPEEEVLAELEKFKSHVIECA 515 >ref|XP_010242216.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Nelumbo nucifera] Length = 465 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVL EL+KFK H+L CS Sbjct: 433 IWRMSDLIYRPEEEVLAELEKFKSHILSCS 462 >ref|XP_010262125.1| PREDICTED: WD-40 repeat-containing protein MSI4 [Nelumbo nucifera] Length = 465 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DL+YRPEEEVL EL+KFK H+L CS Sbjct: 433 IWRMSDLIYRPEEEVLAELEKFKSHILSCS 462 >ref|XP_009804576.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Nicotiana sylvestris] gi|698519423|ref|XP_009804577.1| PREDICTED: WD-40 repeat-containing protein MSI4-like [Nicotiana sylvestris] Length = 491 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 280 IWRMTDLLYRPEEEVLEELQKFKDHVLECS 191 IWRM+DLLYRPEEEVL ELQ+FKDHV +C+ Sbjct: 459 IWRMSDLLYRPEEEVLAELQQFKDHVSKCA 488