BLASTX nr result
ID: Forsythia22_contig00034084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034084 (235 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011031374.1| PREDICTED: kinesin-like protein KIF21A [Popu... 57 6e-06 >ref|XP_011031374.1| PREDICTED: kinesin-like protein KIF21A [Populus euphratica] Length = 256 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 2 KGLSMFYNGKSKSFVNLSGQESKLEMKELEKPDHIVNKKRRLIVAEKLSRKWF 160 +GLS ++GKSKSF NLS + +KELEKP++ NK+RR+++A K SRK F Sbjct: 118 RGLSNHFSGKSKSFTNLSEVNTVNTVKELEKPENPFNKRRRILMANKWSRKSF 170