BLASTX nr result
ID: Forsythia22_contig00034025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034025 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086814.1| PREDICTED: F-box only protein 6 [Sesamum ind... 65 2e-08 ref|XP_012842139.1| PREDICTED: F-box only protein 6 [Erythranthe... 65 2e-08 >ref|XP_011086814.1| PREDICTED: F-box only protein 6 [Sesamum indicum] Length = 468 Score = 64.7 bits (156), Expect = 2e-08 Identities = 36/52 (69%), Positives = 40/52 (76%), Gaps = 5/52 (9%) Frame = -2 Query: 198 MMEGVSILRQFIGQLQELLELYGY--PLSVPSNYFHQFQAQPAP---QHNLR 58 MMEGV++LRQ IGQLQE+LELYG P +VPSNYF Q QAQP P QH LR Sbjct: 1 MMEGVAMLRQLIGQLQEVLELYGSPPPHTVPSNYFIQLQAQPQPESQQHPLR 52 >ref|XP_012842139.1| PREDICTED: F-box only protein 6 [Erythranthe guttatus] gi|604327710|gb|EYU33446.1| hypothetical protein MIMGU_mgv1a005881mg [Erythranthe guttata] Length = 466 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/51 (66%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 198 MMEGVSILRQFIGQLQELLELYGY-PLSVPSNYFHQFQAQPAPQHNLRLLP 49 MMEGV++LRQ IGQLQE+LELYG P +VPSNYF QFQ QP + +LLP Sbjct: 1 MMEGVAMLRQLIGQLQEVLELYGSPPPTVPSNYFIQFQPQPQQPSSEQLLP 51