BLASTX nr result
ID: Forsythia22_contig00032163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00032163 (399 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009594466.1| PREDICTED: putative pentatricopeptide repeat... 149 9e-34 emb|CDO98791.1| unnamed protein product [Coffea canephora] 145 1e-32 ref|XP_009760297.1| PREDICTED: putative pentatricopeptide repeat... 143 4e-32 ref|XP_006355396.1| PREDICTED: putative pentatricopeptide repeat... 141 1e-31 ref|XP_010318851.1| PREDICTED: putative pentatricopeptide repeat... 138 2e-30 ref|XP_011100799.1| PREDICTED: putative pentatricopeptide repeat... 137 3e-30 ref|XP_011020445.1| PREDICTED: putative pentatricopeptide repeat... 134 2e-29 ref|XP_002519191.1| pentatricopeptide repeat-containing protein,... 134 2e-29 ref|XP_010649533.1| PREDICTED: putative pentatricopeptide repeat... 130 3e-28 ref|XP_007224454.1| hypothetical protein PRUPE_ppa022157mg [Prun... 130 3e-28 ref|XP_012084031.1| PREDICTED: putative pentatricopeptide repeat... 128 1e-27 gb|KDP27886.1| hypothetical protein JCGZ_18966 [Jatropha curcas] 128 1e-27 ref|XP_012827726.1| PREDICTED: putative pentatricopeptide repeat... 127 2e-27 gb|EYU44006.1| hypothetical protein MIMGU_mgv1a002242mg [Erythra... 127 2e-27 ref|XP_007035741.1| Pentatricopeptide (PPR) domain protein 40, p... 126 6e-27 ref|XP_008224571.1| PREDICTED: putative pentatricopeptide repeat... 123 4e-26 ref|XP_009344783.1| PREDICTED: putative pentatricopeptide repeat... 121 2e-25 ref|XP_009338665.1| PREDICTED: putative pentatricopeptide repeat... 121 2e-25 ref|XP_006488997.1| PREDICTED: putative pentatricopeptide repeat... 121 2e-25 ref|XP_006488870.1| PREDICTED: putative pentatricopeptide repeat... 121 2e-25 >ref|XP_009594466.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana tomentosiformis] gi|697171074|ref|XP_009594467.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana tomentosiformis] gi|697171076|ref|XP_009594468.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana tomentosiformis] gi|697171078|ref|XP_009594469.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana tomentosiformis] gi|697171080|ref|XP_009594470.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana tomentosiformis] gi|697171082|ref|XP_009594471.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana tomentosiformis] Length = 707 Score = 149 bits (375), Expect = 9e-34 Identities = 71/132 (53%), Positives = 92/132 (69%) Frame = -1 Query: 396 SEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEF 217 +E TS GK S S T I++ G+S+D++YF ++L+R DW LLL+HE+ Sbjct: 48 TEQTSPGKSSLNWS-------SNTSIAAKNRNLQGSSIDYEYFTQILARNDWYLLLNHEY 100 Query: 216 KDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVL 37 K K LN + ++SIL NQENPLH RFYIW+S+ICP FA N + G LGNALYRKGP+L Sbjct: 101 KAKRVTLNQQAVVSILHNQENPLHPFRFYIWISNICPSFAKNQSVKGVLGNALYRKGPLL 160 Query: 36 LSAELIEDIRNS 1 LSAEL++DIRNS Sbjct: 161 LSAELVQDIRNS 172 >emb|CDO98791.1| unnamed protein product [Coffea canephora] Length = 708 Score = 145 bits (365), Expect = 1e-32 Identities = 73/133 (54%), Positives = 86/133 (64%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 N A+ TGK FKD N I ++ + + +DHQYF +LSRKDW +LL E Sbjct: 42 NPAASPTGK-NFKDPNLNPISITSAAVPKQNPRLHSKPIDHQYFTHILSRKDWYILLGQE 100 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 FK + NLN + I+SILQNQENPL LRFYIWV I P F N I G L N LYRKGPV Sbjct: 101 FKARRVNLNCQSIISILQNQENPLLPLRFYIWVLSINPSFGKNQSIRGVLSNTLYRKGPV 160 Query: 39 LLSAELIEDIRNS 1 LLSAEL++DIRNS Sbjct: 161 LLSAELVQDIRNS 173 >ref|XP_009760297.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana sylvestris] gi|698526907|ref|XP_009760298.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana sylvestris] gi|698526909|ref|XP_009760299.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana sylvestris] gi|698526911|ref|XP_009760300.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana sylvestris] gi|698526913|ref|XP_009760301.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana sylvestris] gi|698526915|ref|XP_009760302.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Nicotiana sylvestris] Length = 707 Score = 143 bits (361), Expect = 4e-32 Identities = 69/132 (52%), Positives = 92/132 (69%) Frame = -1 Query: 396 SEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEF 217 +E TS GK N++S T I++ K F G+ +D++YF +L+R DW LLL+HE+ Sbjct: 48 TEQTSPGKSSL---NWRS----NTSIAAKKRNFQGSGIDYEYFTHILARNDWYLLLNHEY 100 Query: 216 KDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVL 37 K K LN + ++SIL NQENPLH RFYIW+S+ICP FA N + G LGN L R+GP+L Sbjct: 101 KAKRVTLNQQAVVSILHNQENPLHPFRFYIWISNICPSFAKNQSVKGVLGNLLCRRGPLL 160 Query: 36 LSAELIEDIRNS 1 LSAEL++DIRNS Sbjct: 161 LSAELVQDIRNS 172 >ref|XP_006355396.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565377884|ref|XP_006355397.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 709 Score = 141 bits (356), Expect = 1e-31 Identities = 65/111 (58%), Positives = 83/111 (74%) Frame = -1 Query: 333 SQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEFKDKWANLNTRIILSILQNQEN 154 S T I++ K F + +DH+YF+++L+RKDW LLL+HE+K K LN + ++SILQNQEN Sbjct: 64 SNTSIAAKKVNFRASVIDHKYFSQILARKDWYLLLNHEYKAKRVTLNQQEVVSILQNQEN 123 Query: 153 PLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLSAELIEDIRNS 1 PLH RFYIWV ICP FA N + L N LYRKGP+LLSAEL++DIRNS Sbjct: 124 PLHPFRFYIWVLKICPSFAKNQSVKVVLSNVLYRKGPLLLSAELVQDIRNS 174 >ref|XP_010318851.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Solanum lycopersicum] gi|723656911|ref|XP_010318854.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Solanum lycopersicum] gi|723656914|ref|XP_010318856.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Solanum lycopersicum] gi|723656917|ref|XP_010318862.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Solanum lycopersicum] Length = 709 Score = 138 bits (347), Expect = 2e-30 Identities = 63/111 (56%), Positives = 81/111 (72%) Frame = -1 Query: 333 SQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEFKDKWANLNTRIILSILQNQEN 154 S T ++ K F +DH+YF+++L+RKDW LLL+HE+K K LN + ++SILQNQEN Sbjct: 64 SNTSVAVKKVNFRATVIDHKYFSQILARKDWYLLLNHEYKAKRVTLNQQEVVSILQNQEN 123 Query: 153 PLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLSAELIEDIRNS 1 PLH RFYIWV ICP FA N + L N L+RKGP+LLSAEL++DIRNS Sbjct: 124 PLHPFRFYIWVVKICPSFAKNQSVKVVLSNVLFRKGPLLLSAELVQDIRNS 174 >ref|XP_011100799.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Sesamum indicum] Length = 710 Score = 137 bits (345), Expect = 3e-30 Identities = 70/133 (52%), Positives = 94/133 (70%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 N + TGK +FKD+ F SI S+ + +F +DH++F+E+L RKDW LLL+HE Sbjct: 45 NPVVSFTGKLEFKDTKFDSI-------SALEKRFVSKPIDHRFFSEILLRKDWYLLLNHE 97 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 FK + NLNT+ ++SILQNQEN L LRFY+W+S++ A N I AL N+LYRKGPV Sbjct: 98 FKSQRLNLNTQTVVSILQNQENALCPLRFYVWLSNVSASLARNQSILSALSNSLYRKGPV 157 Query: 39 LLSAELIEDIRNS 1 LLSAELI++IR+S Sbjct: 158 LLSAELIKEIRSS 170 >ref|XP_011020445.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Populus euphratica] Length = 719 Score = 134 bits (337), Expect = 2e-29 Identities = 68/138 (49%), Positives = 91/138 (65%), Gaps = 5/138 (3%) Frame = -1 Query: 399 NSEATSTGKPQFKDSN-----FKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVL 235 ++EA+ TG N K + V + H+S N+ D SVD Y + +LSR DW L Sbjct: 50 HTEASLTGDNTLSSLNSQLTKHKLLSVPKGHVSHNR---DTRSVDRHYISRILSRNDWFL 106 Query: 234 LLSHEFKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALY 55 LL+HEFK K NLN + ++S+LQNQENP++ LRFYIWVS++ P F N + G L NA Y Sbjct: 107 LLNHEFKAKRINLNPQFVVSVLQNQENPIYPLRFYIWVSNVDPLFIRNQAVKGVLANAFY 166 Query: 54 RKGPVLLSAELIEDIRNS 1 RKGPV+LS +L++DIRNS Sbjct: 167 RKGPVVLSVDLLKDIRNS 184 >ref|XP_002519191.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541506|gb|EEF43055.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 719 Score = 134 bits (337), Expect = 2e-29 Identities = 68/133 (51%), Positives = 90/133 (67%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 NS+ PQF + N S+ +S IS+NKY +DH YF+ +LSR DW LLL+HE Sbjct: 49 NSDTHYLLNPQFTNPN--SLKISNNPISANKYS---KPIDHHYFSRILSRHDWFLLLNHE 103 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 FK K LN+ + S+LQNQENPL+ L+FYIWVS++ P FA + + G L N LYRKGPV Sbjct: 104 FKAKRITLNSHSVASVLQNQENPLYPLKFYIWVSNMDPLFAKDQSVKGVLANCLYRKGPV 163 Query: 39 LLSAELIEDIRNS 1 +LS EL++DI+ S Sbjct: 164 VLSVELLKDIKAS 176 >ref|XP_010649533.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial isoform X1 [Vitis vinifera] Length = 713 Score = 130 bits (328), Expect = 3e-28 Identities = 62/111 (55%), Positives = 82/111 (73%) Frame = -1 Query: 333 SQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEFKDKWANLNTRIILSILQNQEN 154 S + IS + +F S+DHQY +E+LSR+DW LL++HE+K K +LN R+++SILQNQEN Sbjct: 68 SNSPISDHNQEFRVKSIDHQYISEILSREDWFLLINHEYKAKRISLNPRLVVSILQNQEN 127 Query: 153 PLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLSAELIEDIRNS 1 PL+ LRFY+WV I P A N + AL N L RKGPV+LS EL++DIRNS Sbjct: 128 PLYPLRFYVWVLKINPLLAKNQSVRVALANVLNRKGPVILSVELLQDIRNS 178 >ref|XP_007224454.1| hypothetical protein PRUPE_ppa022157mg [Prunus persica] gi|462421390|gb|EMJ25653.1| hypothetical protein PRUPE_ppa022157mg [Prunus persica] Length = 604 Score = 130 bits (327), Expect = 3e-28 Identities = 63/127 (49%), Positives = 83/127 (65%), Gaps = 2/127 (1%) Frame = -1 Query: 375 KPQFKDSNFKSILVSQTHISS--NKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEFKDKWA 202 KP F+ N + +S IS+ +K++ D +DH Y A++LSRKDW LLL HE K K Sbjct: 58 KPNFEPQNPNLVSISTNPISAVNHKFRIDNKRIDHLYIAQILSRKDWFLLLDHELKAKRI 117 Query: 201 NLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLSAEL 22 LN + + S+LQNQE+PLH L+FYIWVS FA N + G L YRKGPV+LS EL Sbjct: 118 FLNPQFVASVLQNQESPLHSLKFYIWVSSTDSLFAKNQSVRGVLAKTFYRKGPVVLSVEL 177 Query: 21 IEDIRNS 1 ++DI+NS Sbjct: 178 LKDIKNS 184 >ref|XP_012084031.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Jatropha curcas] Length = 726 Score = 128 bits (322), Expect = 1e-27 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 4/135 (2%) Frame = -1 Query: 393 EATSTGKP----QFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLS 226 EA+S G F+ S+ S + IS+N Y +DH +F+ +LSR DW LLL+ Sbjct: 52 EASSRGNSPYSLNFQVKRHNSVPTSNSSISANNYS---KPIDHDFFSRILSRNDWFLLLN 108 Query: 225 HEFKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKG 46 HEFK K LN + ++S+LQNQENPL+ L+FYIWVS+I P FA N + L N YR G Sbjct: 109 HEFKAKRIILNPQFVVSVLQNQENPLYPLKFYIWVSNIDPLFAKNQSVKSVLANCFYRNG 168 Query: 45 PVLLSAELIEDIRNS 1 PV+LS +L++DIRNS Sbjct: 169 PVVLSVQLLKDIRNS 183 >gb|KDP27886.1| hypothetical protein JCGZ_18966 [Jatropha curcas] Length = 827 Score = 128 bits (322), Expect = 1e-27 Identities = 65/135 (48%), Positives = 87/135 (64%), Gaps = 4/135 (2%) Frame = -1 Query: 393 EATSTGKP----QFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLS 226 EA+S G F+ S+ S + IS+N Y +DH +F+ +LSR DW LLL+ Sbjct: 153 EASSRGNSPYSLNFQVKRHNSVPTSNSSISANNYS---KPIDHDFFSRILSRNDWFLLLN 209 Query: 225 HEFKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKG 46 HEFK K LN + ++S+LQNQENPL+ L+FYIWVS+I P FA N + L N YR G Sbjct: 210 HEFKAKRIILNPQFVVSVLQNQENPLYPLKFYIWVSNIDPLFAKNQSVKSVLANCFYRNG 269 Query: 45 PVLLSAELIEDIRNS 1 PV+LS +L++DIRNS Sbjct: 270 PVVLSVQLLKDIRNS 284 >ref|XP_012827726.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Erythranthe guttatus] gi|848857019|ref|XP_012827732.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Erythranthe guttatus] Length = 714 Score = 127 bits (320), Expect = 2e-27 Identities = 68/133 (51%), Positives = 88/133 (66%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 NS +S G +FK+S I + HIS+ K +DH+YFAE+LSRKDW LLLSHE Sbjct: 45 NSIDSSIGAFEFKNS----ISTPKPHISAGDTKLSSRPIDHRYFAEILSRKDWYLLLSHE 100 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 FK + NL+ +I +SIL NQ+ L LRFY+W+S A N I AL NA +RKGPV Sbjct: 101 FKAQRINLSPQIAVSILHNQDKGLAPLRFYVWLSSFNALLAKNKSILSALSNAFFRKGPV 160 Query: 39 LLSAELIEDIRNS 1 LLSAELI++++NS Sbjct: 161 LLSAELIQEVKNS 173 >gb|EYU44006.1| hypothetical protein MIMGU_mgv1a002242mg [Erythranthe guttata] Length = 696 Score = 127 bits (320), Expect = 2e-27 Identities = 68/133 (51%), Positives = 88/133 (66%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 NS +S G +FK+S I + HIS+ K +DH+YFAE+LSRKDW LLLSHE Sbjct: 45 NSIDSSIGAFEFKNS----ISTPKPHISAGDTKLSSRPIDHRYFAEILSRKDWYLLLSHE 100 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 FK + NL+ +I +SIL NQ+ L LRFY+W+S A N I AL NA +RKGPV Sbjct: 101 FKAQRINLSPQIAVSILHNQDKGLAPLRFYVWLSSFNALLAKNKSILSALSNAFFRKGPV 160 Query: 39 LLSAELIEDIRNS 1 LLSAELI++++NS Sbjct: 161 LLSAELIQEVKNS 173 >ref|XP_007035741.1| Pentatricopeptide (PPR) domain protein 40, putative [Theobroma cacao] gi|508714770|gb|EOY06667.1| Pentatricopeptide (PPR) domain protein 40, putative [Theobroma cacao] Length = 679 Score = 126 bits (316), Expect = 6e-27 Identities = 61/99 (61%), Positives = 76/99 (76%), Gaps = 1/99 (1%) Frame = -1 Query: 294 GNS-VDHQYFAEVLSRKDWVLLLSHEFKDKWANLNTRIILSILQNQENPLHLLRFYIWVS 118 GNS ++H Y +++LSR DW LLL+HE K K LN + ++S+LQNQENPL+ LRFYIWVS Sbjct: 46 GNSAINHHYISQILSRNDWFLLLNHELKAKRIVLNPQFVVSLLQNQENPLYPLRFYIWVS 105 Query: 117 DICPQFANNHLIHGALGNALYRKGPVLLSAELIEDIRNS 1 +I P FA N + G L ALYRKGPVLLS EL++DIRNS Sbjct: 106 NIDPLFAKNQSVKGVLATALYRKGPVLLSVELVKDIRNS 144 >ref|XP_008224571.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Prunus mume] Length = 712 Score = 123 bits (309), Expect = 4e-26 Identities = 61/127 (48%), Positives = 79/127 (62%), Gaps = 2/127 (1%) Frame = -1 Query: 375 KPQFKDSNFKSILVSQTHISSNKYKF--DGNSVDHQYFAEVLSRKDWVLLLSHEFKDKWA 202 KP F+ N + +S IS+ +KF D +DH Y ++LSR DW LLL HE K K Sbjct: 58 KPNFEPQNPNLVSISTNPISAVNHKFRVDNKRIDHLYITQILSRNDWFLLLDHELKAKRI 117 Query: 201 NLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLSAEL 22 LN + + S+LQNQE+PLH L+FYIWVS FA N + G L Y KGPV+LS EL Sbjct: 118 FLNPQFVASVLQNQESPLHSLKFYIWVSSTDSLFAKNQSVRGVLAKTFYWKGPVVLSVEL 177 Query: 21 IEDIRNS 1 ++DI+NS Sbjct: 178 LKDIKNS 184 >ref|XP_009344783.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Pyrus x bretschneideri] gi|694435223|ref|XP_009344784.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Pyrus x bretschneideri] Length = 729 Score = 121 bits (304), Expect = 2e-25 Identities = 61/133 (45%), Positives = 79/133 (59%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 NS T P F + +S IS+ + +DH Y ++LSRKDW LLL+HE Sbjct: 74 NSSCTPNPNPNF-------VSISNIPISAGNAHHNHKPIDHSYIVQILSRKDWFLLLAHE 126 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 K LN + + S+LQNQENP L+FY+WVS I P F+ N + G L N LYRKGPV Sbjct: 127 LKAMRIVLNPQFVASVLQNQENPSLSLKFYLWVSSIDPLFSKNQSVRGILANTLYRKGPV 186 Query: 39 LLSAELIEDIRNS 1 +LS EL+ DI+NS Sbjct: 187 VLSVELLNDIKNS 199 >ref|XP_009338665.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial [Pyrus x bretschneideri] Length = 729 Score = 121 bits (304), Expect = 2e-25 Identities = 61/133 (45%), Positives = 79/133 (59%) Frame = -1 Query: 399 NSEATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHE 220 NS T P F + +S IS+ + +DH Y ++LSRKDW LLL+HE Sbjct: 74 NSSCTPNPNPNF-------VSISNIPISAGNAHHNHKPIDHSYIVQILSRKDWFLLLAHE 126 Query: 219 FKDKWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPV 40 K LN + + S+LQNQENP L+FY+WVS I P F+ N + G L N LYRKGPV Sbjct: 127 LKAMRIVLNPQFVASVLQNQENPSLSLKFYLWVSSIDPLFSKNQSVRGILANTLYRKGPV 186 Query: 39 LLSAELIEDIRNS 1 +LS EL+ DI+NS Sbjct: 187 VLSVELLNDIKNS 199 >ref|XP_006488997.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Citrus sinensis] Length = 740 Score = 121 bits (304), Expect = 2e-25 Identities = 62/130 (47%), Positives = 83/130 (63%) Frame = -1 Query: 390 ATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEFKD 211 ++S F NF + +S H+S + D +DH Y ++ L+RKDW LLLSHE K Sbjct: 62 SSSLNSHNFSKLNF--VTLSSNHVSPHS---DVKLIDHHYISQALARKDWFLLLSHELKA 116 Query: 210 KWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLS 31 NL R+ +SILQNQENP+H LRFYIW S+I A + + G LGN L+R GPV+LS Sbjct: 117 NRINLVPRVAVSILQNQENPIHSLRFYIWASNINLLLAKDQSVKGVLGNVLHRMGPVILS 176 Query: 30 AELIEDIRNS 1 EL++DI+NS Sbjct: 177 VELLKDIKNS 186 >ref|XP_006488870.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Citrus sinensis] Length = 721 Score = 121 bits (304), Expect = 2e-25 Identities = 62/130 (47%), Positives = 83/130 (63%) Frame = -1 Query: 390 ATSTGKPQFKDSNFKSILVSQTHISSNKYKFDGNSVDHQYFAEVLSRKDWVLLLSHEFKD 211 ++S F NF + +S H+S + D +DH Y ++ L+RKDW LLLSHE K Sbjct: 62 SSSLNSHNFSKLNF--VTLSSNHVSPHS---DVKLIDHHYISQALARKDWFLLLSHELKA 116 Query: 210 KWANLNTRIILSILQNQENPLHLLRFYIWVSDICPQFANNHLIHGALGNALYRKGPVLLS 31 NL R+ +SILQNQENP+H LRFYIW S+I A + + G LGN L+R GPV+LS Sbjct: 117 NRINLVPRVAVSILQNQENPIHSLRFYIWASNINLLLAKDQSVKGVLGNVLHRMGPVILS 176 Query: 30 AELIEDIRNS 1 EL++DI+NS Sbjct: 177 VELLKDIKNS 186