BLASTX nr result
ID: Forsythia22_contig00031743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031743 (196 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097304.1| PREDICTED: putative calcium-binding protein ... 96 9e-18 ref|XP_011098857.1| PREDICTED: putative calcium-binding protein ... 93 6e-17 ref|XP_012458473.1| PREDICTED: calcium-binding protein CML38-lik... 91 4e-16 ref|XP_008231145.1| PREDICTED: calcium-binding protein CML38 [Pr... 91 4e-16 ref|XP_007216735.1| hypothetical protein PRUPE_ppa025431mg [Prun... 91 4e-16 ref|XP_012840553.1| PREDICTED: probable calcium-binding protein ... 89 1e-15 ref|XP_010026630.1| PREDICTED: putative calcium-binding protein ... 88 3e-15 ref|XP_012844348.1| PREDICTED: putative calcium-binding protein ... 87 3e-15 ref|XP_012840554.1| PREDICTED: putative calcium-binding protein ... 87 4e-15 ref|XP_012840552.1| PREDICTED: putative calcium-binding protein ... 86 7e-15 ref|XP_010026622.1| PREDICTED: probable calcium-binding protein ... 86 1e-14 ref|XP_011467704.1| PREDICTED: calcium-binding protein CML38 [Fr... 85 2e-14 gb|KHN21325.1| Putative calcium-binding protein CML19 [Glycine s... 85 2e-14 ref|XP_003538266.2| PREDICTED: calmodulin-like protein 12-like [... 85 2e-14 gb|KHN21326.1| Putative calcium-binding protein CML19 [Glycine s... 84 3e-14 emb|CDP16678.1| unnamed protein product [Coffea canephora] 84 3e-14 ref|XP_006447105.1| hypothetical protein CICLE_v10018267mg [Citr... 84 3e-14 gb|KDO55620.1| hypothetical protein CISIN_1g037913mg [Citrus sin... 84 4e-14 gb|AFK45118.1| unknown [Lotus japonicus] 84 4e-14 ref|XP_010270643.1| PREDICTED: calcium-binding protein CML38-lik... 84 5e-14 >ref|XP_011097304.1| PREDICTED: putative calcium-binding protein CML23 [Sesamum indicum] Length = 142 Score = 95.9 bits (237), Expect = 9e-18 Identities = 46/63 (73%), Positives = 52/63 (82%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKI P EL++CVG IGG M+ EEAEAA+V MDSD DG LCLEDFV++VE AGEEEK Sbjct: 18 GDGKICPAELRQCVGSIGGEMTAEEAEAAVVIMDSDGDGLLCLEDFVRIVEGAGEEEKAG 77 Query: 14 DLK 6 DLK Sbjct: 78 DLK 80 >ref|XP_011098857.1| PREDICTED: putative calcium-binding protein CML23, partial [Sesamum indicum] Length = 125 Score = 93.2 bits (230), Expect = 6e-17 Identities = 45/63 (71%), Positives = 52/63 (82%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKI P ELQ+CVG IGG M+ EEA AA+V MDSD DG LCL+DFV++VE AGEEEK + Sbjct: 18 GDGKICPVELQRCVGSIGGEMTEEEAVAAVVLMDSDGDGLLCLDDFVRIVEGAGEEEKAS 77 Query: 14 DLK 6 DLK Sbjct: 78 DLK 80 >ref|XP_012458473.1| PREDICTED: calcium-binding protein CML38-like [Gossypium raimondii] gi|763809513|gb|KJB76415.1| hypothetical protein B456_012G087800 [Gossypium raimondii] Length = 140 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/63 (69%), Positives = 51/63 (80%) Frame = -3 Query: 191 DGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVND 12 DGKISP ELQ+CV IGG +S EEAE A+ +D+D DG L LEDF++LVEE GEEEKVND Sbjct: 19 DGKISPAELQQCVKAIGGELSREEAEVAVEVLDTDGDGLLGLEDFIRLVEEVGEEEKVND 78 Query: 11 LKE 3 LKE Sbjct: 79 LKE 81 >ref|XP_008231145.1| PREDICTED: calcium-binding protein CML38 [Prunus mume] Length = 143 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISP ELQ+CV IGG +SL EAE A+ +DSD DG LCL+DFVK V+ EEEKVN Sbjct: 18 GDGKISPLELQQCVRAIGGELSLTEAEVAVEHLDSDGDGLLCLDDFVKFVDGGREEEKVN 77 Query: 14 DLKE 3 DLKE Sbjct: 78 DLKE 81 >ref|XP_007216735.1| hypothetical protein PRUPE_ppa025431mg [Prunus persica] gi|462412885|gb|EMJ17934.1| hypothetical protein PRUPE_ppa025431mg [Prunus persica] Length = 143 Score = 90.5 bits (223), Expect = 4e-16 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISP ELQ+CV IGG +SL EAE A+ +DSD DG LCL+DFVK V+ EEEKVN Sbjct: 18 GDGKISPLELQQCVRAIGGELSLTEAEVAVEHLDSDGDGLLCLDDFVKFVDGGREEEKVN 77 Query: 14 DLKE 3 DLKE Sbjct: 78 DLKE 81 >ref|XP_012840553.1| PREDICTED: probable calcium-binding protein CML31 [Erythranthe guttatus] gi|604329463|gb|EYU34794.1| hypothetical protein MIMGU_mgv1a015890mg [Erythranthe guttata] Length = 142 Score = 89.0 bits (219), Expect = 1e-15 Identities = 42/63 (66%), Positives = 51/63 (80%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDG+ISP EL++CV IGGVM+ EEA AA+ DSD DG +CL+DFVK+VE AGEEEK + Sbjct: 18 GDGRISPAELRQCVCTIGGVMTAEEAAAAVALTDSDGDGLMCLDDFVKVVEGAGEEEKTS 77 Query: 14 DLK 6 DLK Sbjct: 78 DLK 80 >ref|XP_010026630.1| PREDICTED: putative calcium-binding protein CML19 [Eucalyptus grandis] gi|629118685|gb|KCW83175.1| hypothetical protein EUGRSUZ_B00128 [Eucalyptus grandis] Length = 141 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGK+SP EL++ VGLIGG + LEE E A+ S+DSD DG LCLEDFV L+E GEEEK+ Sbjct: 19 GDGKLSPLELRRQVGLIGGELLLEEVEVAVESLDSDGDGLLCLEDFVGLMEGGGEEEKMG 78 Query: 14 DLKE 3 DL+E Sbjct: 79 DLRE 82 >ref|XP_012844348.1| PREDICTED: putative calcium-binding protein CML23 [Erythranthe guttatus] gi|604347089|gb|EYU45393.1| hypothetical protein MIMGU_mgv1a021519mg [Erythranthe guttata] Length = 138 Score = 87.4 bits (215), Expect = 3e-15 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKI P EL++CVG +GG M+ EEA AA+V MD D DG L LEDFV++VE AG+EEK + Sbjct: 16 GDGKICPVELRRCVGSVGGEMTEEEAAAAVVLMDGDGDGLLGLEDFVRIVEGAGDEEKAS 75 Query: 14 DLKE 3 DLKE Sbjct: 76 DLKE 79 >ref|XP_012840554.1| PREDICTED: putative calcium-binding protein CML23 [Erythranthe guttatus] Length = 142 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/63 (65%), Positives = 50/63 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDG+ISP EL+ CV IGGVM+ EAEAA+ +DSD DG +CL+DFV++VE AGEEEK Sbjct: 18 GDGRISPEELRHCVASIGGVMTAAEAEAAVALVDSDGDGLMCLDDFVRIVEGAGEEEKAR 77 Query: 14 DLK 6 DLK Sbjct: 78 DLK 80 >ref|XP_012840552.1| PREDICTED: putative calcium-binding protein CML23 [Erythranthe guttatus] gi|604329462|gb|EYU34793.1| hypothetical protein MIMGU_mgv1a021590mg [Erythranthe guttata] Length = 142 Score = 86.3 bits (212), Expect = 7e-15 Identities = 40/63 (63%), Positives = 52/63 (82%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDG+ISP EL+ CV IGGVM+ +EAEAA+ +DSD DG +CL+DFV++VE AG+EEK + Sbjct: 18 GDGRISPEELRHCVASIGGVMTADEAEAAVALVDSDGDGQMCLDDFVRIVEGAGDEEKAS 77 Query: 14 DLK 6 DLK Sbjct: 78 DLK 80 >ref|XP_010026622.1| PREDICTED: probable calcium-binding protein CML31 [Eucalyptus grandis] gi|629118684|gb|KCW83174.1| hypothetical protein EUGRSUZ_B00127 [Eucalyptus grandis] Length = 143 Score = 85.9 bits (211), Expect = 1e-14 Identities = 39/64 (60%), Positives = 50/64 (78%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGK+SP EL++CVGL GG + L+E E A+ S+DSD DG LCLEDFV +E GEEE++ Sbjct: 21 GDGKLSPSELRRCVGLTGGEVLLKEVEVAVESLDSDGDGLLCLEDFVGFMEGGGEEERMG 80 Query: 14 DLKE 3 DL+E Sbjct: 81 DLRE 84 >ref|XP_011467704.1| PREDICTED: calcium-binding protein CML38 [Fragaria vesca subsp. vesca] Length = 140 Score = 84.7 bits (208), Expect = 2e-14 Identities = 42/64 (65%), Positives = 48/64 (75%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISP ELQ+CV IGG +S EAEAA+ +DSD DG L +DFVK VE EEEKVN Sbjct: 18 GDGKISPMELQQCVEAIGGELSSSEAEAAVEYLDSDRDGLLGFDDFVKFVEGGDEEEKVN 77 Query: 14 DLKE 3 DL+E Sbjct: 78 DLRE 81 >gb|KHN21325.1| Putative calcium-binding protein CML19 [Glycine soja] Length = 139 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISPCEL+ +G+IGG + ++AE I +DSD DGFL LEDFVKL+E AGE+EK+ Sbjct: 16 GDGKISPCELRNRLGMIGGELLAKDAEKLIEELDSDGDGFLSLEDFVKLMEAAGEDEKLK 75 Query: 14 DLKE 3 DL+E Sbjct: 76 DLEE 79 >ref|XP_003538266.2| PREDICTED: calmodulin-like protein 12-like [Glycine max] Length = 272 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISPCEL+ +G+IGG + ++AE I +DSD DGFL LEDFVKL+E AGE+EK+ Sbjct: 18 GDGKISPCELRNRLGMIGGELLAKDAEKLIEELDSDGDGFLSLEDFVKLMEAAGEDEKLK 77 Query: 14 DLKE 3 DL+E Sbjct: 78 DLEE 81 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISPCEL+ +G+IGG + ++AE I +DSD DGFL LEDFVKL+E AGE+EK+ Sbjct: 149 GDGKISPCELRNRLGMIGGELLTKDAEKLIEELDSDGDGFLSLEDFVKLMEAAGEDEKLK 208 Query: 14 DLKE 3 DL+E Sbjct: 209 DLEE 212 >gb|KHN21326.1| Putative calcium-binding protein CML19 [Glycine soja] Length = 141 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISPCEL+ +G+IGG + ++AE I +DSD DGFL LEDFVKL+E AGE+EK+ Sbjct: 18 GDGKISPCELRNRLGMIGGELLSKDAEKLIEELDSDGDGFLSLEDFVKLMEAAGEDEKLK 77 Query: 14 DLKE 3 DL+E Sbjct: 78 DLEE 81 >emb|CDP16678.1| unnamed protein product [Coffea canephora] Length = 141 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/62 (66%), Positives = 50/62 (80%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKIS ELQ+CV +GG MS+EE+EAA+ MD+D DG LCLEDFV++VE AG+EEK Sbjct: 18 GDGKISASELQQCVASMGGEMSVEESEAAVRLMDTDGDGLLCLEDFVRIVEGAGDEEKGA 77 Query: 14 DL 9 DL Sbjct: 78 DL 79 >ref|XP_006447105.1| hypothetical protein CICLE_v10018267mg [Citrus clementina] gi|568831558|ref|XP_006470029.1| PREDICTED: calcium-binding protein CML38-like [Citrus sinensis] gi|557549716|gb|ESR60345.1| hypothetical protein CICLE_v10018267mg [Citrus clementina] Length = 141 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/64 (64%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GD KISP E+Q+CV IGG +SL EAEAA+ +D+D DG L +DFV+LVE +GEEEK+N Sbjct: 19 GDRKISPSEIQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRLVEGSGEEEKMN 78 Query: 14 DLKE 3 DLKE Sbjct: 79 DLKE 82 >gb|KDO55620.1| hypothetical protein CISIN_1g037913mg [Citrus sinensis] Length = 141 Score = 84.0 bits (206), Expect = 4e-14 Identities = 41/64 (64%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GD +ISP ELQ+CV IGG +SL EAEAA+ +D+D DG L +DFV+LVE +GEEEK+N Sbjct: 19 GDRRISPSELQQCVEAIGGELSLAEAEAAVEFLDADGDGLLGFDDFVRLVEGSGEEEKMN 78 Query: 14 DLKE 3 DLKE Sbjct: 79 DLKE 82 >gb|AFK45118.1| unknown [Lotus japonicus] Length = 140 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/64 (62%), Positives = 51/64 (79%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GD KISP EL++ + ++GG + L+EAE AI + DSD DGFLCLED VKL+E AGEEEK+ Sbjct: 18 GDSKISPSELKRRLAVMGGELRLKEAEMAIEAFDSDGDGFLCLEDLVKLMESAGEEEKLK 77 Query: 14 DLKE 3 DL+E Sbjct: 78 DLRE 81 >ref|XP_010270643.1| PREDICTED: calcium-binding protein CML38-like [Nelumbo nucifera] Length = 193 Score = 83.6 bits (205), Expect = 5e-14 Identities = 41/64 (64%), Positives = 49/64 (76%) Frame = -3 Query: 194 GDGKISPCELQKCVGLIGGVMSLEEAEAAIVSMDSDEDGFLCLEDFVKLVEEAGEEEKVN 15 GDGKISP ELQ CV ++GG MS EEAEAA+ S DSD DG +DFVKL+E +GEEE+ Sbjct: 71 GDGKISPEELQSCVRMVGGEMSTEEAEAAVESSDSDGDGLFGYDDFVKLMEVSGEEERQK 130 Query: 14 DLKE 3 DL+E Sbjct: 131 DLRE 134