BLASTX nr result
ID: Forsythia22_contig00031685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031685 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075417.1| PREDICTED: nudix hydrolase 16, mitochondrial... 70 5e-10 ref|XP_011079067.1| PREDICTED: nudix hydrolase 16, mitochondrial... 67 6e-09 ref|XP_012828215.1| PREDICTED: nudix hydrolase 16, mitochondrial... 67 6e-09 ref|XP_012857496.1| PREDICTED: nudix hydrolase 16, mitochondrial... 61 3e-07 gb|EPS66474.1| hypothetical protein M569_08304 [Genlisea aurea] 57 6e-06 >ref|XP_011075417.1| PREDICTED: nudix hydrolase 16, mitochondrial-like isoform X1 [Sesamum indicum] gi|747058173|ref|XP_011075419.1| PREDICTED: nudix hydrolase 16, mitochondrial-like isoform X1 [Sesamum indicum] Length = 187 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/42 (76%), Positives = 33/42 (78%) Frame = +3 Query: 3 AIECCRHAWMREALEKGFSNWYADCMIHTLPKKDVLK*SCNQ 128 AIECCRH WMREALEKGFS WYAD MI TLPKKD S +Q Sbjct: 145 AIECCRHVWMREALEKGFSKWYADGMISTLPKKDFPNSSSDQ 186 >ref|XP_011079067.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Sesamum indicum] Length = 187 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 3 AIECCRHAWMREALEKGFSNWYADCMIHTLPKKDVLK*SCNQH 131 AIE CRHAWMR+ALEKGFSNWYAD MI TL +K S NQH Sbjct: 145 AIESCRHAWMRDALEKGFSNWYADGMIPTLQRKGFPNSSSNQH 187 >ref|XP_012828215.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Erythranthe guttatus] gi|604298629|gb|EYU18631.1| hypothetical protein MIMGU_mgv1a014732mg [Erythranthe guttata] Length = 180 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +3 Query: 3 AIECCRHAWMREALEKGFSNWYADCMIHTLPKK 101 AIECCRH WMREALEKGFSNWY D M+ TLPKK Sbjct: 145 AIECCRHVWMREALEKGFSNWYNDGMVTTLPKK 177 >ref|XP_012857496.1| PREDICTED: nudix hydrolase 16, mitochondrial-like [Erythranthe guttatus] Length = 187 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 3 AIECCRHAWMREALEKGFSNWYADCMIHTLPKK 101 AIECCRHAWMREAL++GFS WYAD M TLP++ Sbjct: 145 AIECCRHAWMREALDQGFSKWYADGMNRTLPRQ 177 >gb|EPS66474.1| hypothetical protein M569_08304 [Genlisea aurea] Length = 177 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = +3 Query: 3 AIECCRHAWMREALEKGFSNWYADCMIHTLPK 98 AIECCRH+WMREALE GF WYAD M+ T+ K Sbjct: 144 AIECCRHSWMREALENGFQKWYADGMLCTIVK 175