BLASTX nr result
ID: Forsythia22_contig00031633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031633 (312 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207872.1| hypothetical protein PRUPE_ppa021885mg, part... 54 3e-07 >ref|XP_007207872.1| hypothetical protein PRUPE_ppa021885mg, partial [Prunus persica] gi|462403514|gb|EMJ09071.1| hypothetical protein PRUPE_ppa021885mg, partial [Prunus persica] Length = 205 Score = 53.9 bits (128), Expect(3) = 3e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 249 SRQKSRLLGLMKEGSSSLRRLFDMEHTNLGNYLKDNSG 136 +R+ S LLGLMK G++SLRRLFDMEHT+L N+ +D SG Sbjct: 61 ARKSSSLLGLMKVGNTSLRRLFDMEHTSLANHFEDFSG 98 Score = 23.9 bits (50), Expect(3) = 3e-07 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 154 FEG*QWSPIIKPILLW 107 FE S IIKPILLW Sbjct: 93 FEDFSGSSIIKPILLW 108 Score = 22.3 bits (46), Expect(3) = 3e-07 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 107 GSDSDEEFKMINGWNSQIRWGQV 39 GSD+D E +M + W S ++G + Sbjct: 109 GSDTDNENEMHDPWQSIKQFGPI 131