BLASTX nr result
ID: Forsythia22_contig00031597
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00031597 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099102.1| PREDICTED: probable beta-1,4-xylosyltransfer... 60 6e-07 ref|XP_012840803.1| PREDICTED: probable beta-1,4-xylosyltransfer... 57 6e-06 >ref|XP_011099102.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX14 [Sesamum indicum] Length = 505 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 109 MKLLTALKQQGRRSNSFRNASSPLDSAVDGGVKSQA 2 MK LTAL+QQGRRSNSFRNASSPLD+ VDG +KS A Sbjct: 1 MKQLTALQQQGRRSNSFRNASSPLDATVDGAIKSPA 36 >ref|XP_012840803.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX14H [Erythranthe guttatus] gi|604329221|gb|EYU34558.1| hypothetical protein MIMGU_mgv1a004664mg [Erythranthe guttata] Length = 516 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 109 MKLLTALKQQGRRSNSFRNASSPLDSAVDGGVKSQA 2 MK LTAL+QQ RRSNSFR+A+SPLD+AVDG VKS A Sbjct: 1 MKQLTALQQQARRSNSFRSAASPLDAAVDGSVKSPA 36